• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated XBP1S/XBP1U Polyclonal antibody

XBP1S/XBP1U Polyclonal Antibody for FC (Intra)

Cat No. CL488-24168

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

FC (Intra)

XBP1, X-box-binding protein 1, luminal form, X-box-binding protein 1, cytoplasmic form, X-box-binding protein 1, X box binding protein 1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-24168 targets XBP1S/XBP1U in FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag21454

Product name: Recombinant human XBP1 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-167 aa of BC000938

Sequence: MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLREKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAAL

Predict reactive species
Full Name X-box binding protein 1
Calculated Molecular Weight 261 aa, 29 kDa
Observed Molecular Weight ~32 kDa; ~60 kDa
GenBank Accession NumberBC000938
Gene Symbol XBP1
Gene ID (NCBI) 7494
RRIDAB_3672760
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP17861
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

XBP1 is also named as XBP2, belongs to the bZIP family. The X-box-binding protein-1 (XBP1) is a transcriptional regulator of the ER stress response that lies downstream of inositol-requiring enzyme 1 (IRE1α) activation (PMID: 14559994). IRE1α possesses both kinase and ribonuclease activity and processes XBP1 mRNA to produce an active transcription factor in response to ER stress (PMID: 11779464, 11780124). It has been found that upon accumulation of unfolded proteins in the endoplasmic reticulum, the mRNA of this gene is processed to an active form by an unconventional splicing mechanism that is mediated by the endonuclease inositol-requiring enzyme 1. The resulting loss of 26 nt from the spliced mRNA causes a frame-shift and an isoform XBP1S, which is the functionally active transcription factor. The isoform encoded by the unspliced mRNA, XBP1U, is constitutively expressed, and thought to function as a negative feedback regulator of XBP1S, which shuts off transcription of target genes during the recovery phase of ER stress (PMID: 11850408). The unspliced XBP1U isoform is composed of 261 amino acid residues, and the spliced XBP1S isoform is composed of 376 amino acid residues. The XBP1 antibody (24168-1-AP) can detect both XBP1U and XBP1S.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 XBP1S/XBP1U antibody CL488-24168Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...