• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated ZKSCAN1 Polyclonal antibody

ZKSCAN1 Polyclonal Antibody for IF/ICC
Cat No. CL488-25214

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

9130423L19Rik, KOX18, PHZ 37, Zinc finger protein 139, Zinc finger protein 36, Zinc finger protein KOX18, ZKSCAN1, ZNF139, ZNF36

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-25214 targets ZKSCAN1 in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19721

Product name: Recombinant human ZKSCAN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 170-382 aa of BC022378

Sequence: DLHHEATQSHFKHSSRKPRLLQSRALPAAHIPAPPHEGSPRDQAMASALFTADSQAMVKIEDMAVSLILEEWGCQNLARRNLSRDNRQENYGSAFPQGGENRNENEESTSKAETSEDSASRGETTGRSQKEFGEKRDQEGKTGERQQKNPEEKTRKEKRDSGPAIGKDKKTITGERGPREKGKGLGRSFSLSSNFTTPEEVPTGTKSHRCDEC

Predict reactive species
Full Name zinc finger with KRAB and SCAN domains 1
Calculated Molecular Weight 563 aa, 64 kDa
Observed Molecular Weight64 kDa
GenBank Accession NumberBC022378
Gene Symbol ZKSCAN1
Gene ID (NCBI) 7586
RRIDAB_3672789
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP17029
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ZKSCAN1(Zinc finger protein with KRAB and SCAN domains 1), also named as ZNF139, is a member in transcription factor zinc finger protein family(PMID: 24515389). Zinc finger protein 139 (ZNF139) gene is proved play an important role in gastric cancer, overexpression of ZNF139 correlated with tumor differentiation, invasion depth, clinical stage, lymphatic metastasis, and blood vessel invasion(PMID: 25436386, PMID: 25561801). The molecular weight of ZKSCAN1 is 64 kDa.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 ZKSCAN1 antibody CL488-25214Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...