ZMPSTE24 Recombinant monoclonal antibody

• 

  IF Staining of PC-3 using 84547-2-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using ZMPSTE24 antibody (84547-2-RR, Clone: 241288C3 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 84547-2-RR

  Biolayer interferometry (BLl) kinetic assays of 84547-2-RR against Human ZMPSTE24 were performed. The affinity constant is below 1 pM.

ZMPSTE24 Recombinant Antibody for IF/ICC, ELISA

Cat No. 84547-2-RR

Clone No.241288C3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, ELISA

Synonyms

FACE-1, FACE1, FACE 1, EC:3.4.24.84, CAAX prenyl protease 1 homolog

---

Tested Applications

• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84547-2-RR targets ZMPSTE24 in IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33613

  Product name: Recombinant human ZMPSTE24 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 225-475 aa of BC037283

  Sequence: TPLPEGKLKEEIEVMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVLNKDIQEDSGMEPRNEEEGNSEEIKAKVKNKKQGCKNEEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMWHYSHPPLLERLQALKTMKQH*

• Full Name: zinc metallopeptidase (STE24 homolog, S. cerevisiae)
• Calculated Molecular Weight: 475 aa, 55 kDa
• GenBank Accession Number: BC037283
• Gene Symbol: ZMPSTE24
• Gene ID (NCBI): 10269
• RRID: AB_3672054
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O75844
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZMPSTE24(CAAX prenyl protease 1 homolog) gene encodes a zinc metalloproteinase involved in the processing of farnesylated proteins(PubMed: 10373325). The significance of ZMPSTE24 in human disease stems from its role as an enzyme necessary for the correct processing and maturation of lamin A ,an intermediate filament component of the nuclear envelope (PubMed: 16297189).