CoraLite® Plus 488-conjugated ZMPSTE24 Recombinant monoclonal antibody

• 

  IF Staining of PC-3 using CL488-84547-2

  Immunofluorescent analysis of (4% PFA) fixed PC-3 cells using CoraLite® Plus 488 ZMPSTE24 antibody (CL488-84547-2, Clone: 241288C3 ) at dilution of 1:200.

ZMPSTE24 Recombinant Antibody for IF/ICC

Cat No. CL488-84547-2

Clone No.241288C3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

FACE-1, FACE1, FACE 1, EC:3.4.24.84, CAAX prenyl protease 1 homolog

---

Tested Applications

• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84547-2 targets ZMPSTE24 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33613

  Product name: Recombinant human ZMPSTE24 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 225-475 aa of BC037283

  Sequence: TPLPEGKLKEEIEVMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVLNKDIQEDSGMEPRNEEEGNSEEIKAKVKNKKQGCKNEEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMWHYSHPPLLERLQALKTMKQH*

• Full Name: zinc metallopeptidase (STE24 homolog, S. cerevisiae)
• Calculated Molecular Weight: 475 aa, 55 kDa
• GenBank Accession Number: BC037283
• Gene Symbol: ZMPSTE24
• Gene ID (NCBI): 10269
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75844
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

ZMPSTE24(CAAX prenyl protease 1 homolog) gene encodes a zinc metalloproteinase involved in the processing of farnesylated proteins(PubMed: 10373325). The significance of ZMPSTE24 in human disease stems from its role as an enzyme necessary for the correct processing and maturation of lamin A ,an intermediate filament component of the nuclear envelope (PubMed: 16297189).