ZSCAN29 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZSCAN29 Polyclonal antibody, PBS Only (21630-1-PBS)

• 

  WB analysis using 21630-1-AP (same clone as 21630-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21630-1-AP (ZSCAN29 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21630-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 21630-1-AP (same clone as 21630-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 21630-1-AP (ZSCAN29 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21630-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 21630-1-AP (same clone as 21630-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 21630-1-AP (ZSCAN29 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21630-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 21630-1-AP (same clone as 21630-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 21630-1-AP (ZSCAN29 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21630-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 21630-1-AP (same clone as 21630-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 21630-1-AP (ZSCAN29 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21630-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 21630-1-AP (same clone as 21630-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 21630-1-AP (ZSCAN29 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21630-1-PBS in a different storage buffer formulation.

ZSCAN29 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 21630-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

Zfp690, Zinc finger and SCAN domain-containing protein 29, ZNF690

---

Product Information

21630-1-PBS targets ZSCAN29 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16239

  Product name: Recombinant human ZSCAN29 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 99-304 aa of BC109271

  Sequence: PGRPRSSVTVSVKGQEVRLEKMTPPKSSQELLSVRQESVEPQPRGVPKKERARSPDLGPQEQMNPKEKLKPFQRSGFEAGFENEDNSKRDISEEVQLHRTLLARSERKIPRYLHQGKGNESDCRSGRQWAKTSGEKRGKLTLPEKSLSEVLSQQRPCLGERPYKYLKYSKSFGPNSLLMHQVSHQVENPYKCADCGKSFSRSARLI

• Full Name: zinc finger and SCAN domain containing 29
• Calculated Molecular Weight: 852 aa, 97 kDa
• Observed Molecular Weight: 96-97 kDa
• GenBank Accession Number: BC109271
• Gene Symbol: ZSCAN29
• Gene ID (NCBI): 146050
• RRID: AB_3085664
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IWY8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZSCAN29 (zinc finger and SCAN domain containing 29), also named as ZNF690 or Zfp690. It is predicted to be located in nucleus and ubiquitous expression in testis and lymph node. The calculated molecular weight of ZSCAN29 is 96 kDa. The genes ZSCAN29 (associated with five disorders: SCZ, BIP, MD, ASD and ADHD) and ZSCAN31 (associated with three disorders: SCZ, BIP and MD) encode zing finger transcription factor proteins that belong to the krueppel C2H2-type zinc-finger protein family. Zinc finger proteins are essential in multiple regulatory mechanisms and some have been associated with psychiatric disorders as reviewed by Squassina et al., 2019 (PMID: 34637873). It also enables sequence-specific double-stranded DNA binding activity and be predicted to be involved in regulation of transcription by RNA polymerase II.