ZW10 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• ZW10 Recombinant monoclonal antibody, PBS Only (86726-1-PBS)

• 

  WB analysis using 86726-1-RR (same clone as 86726-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86726-1-RR (ZW10 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86726-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 86726-1-RR (same clone as 86726-1-PBS)

  WB result of ZW10 antibody (86726-1-RR; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-ZW10 transfected HeLa cells. This data was developed using the same antibody clone with 86726-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 86726-1-RR (same clone as 86726-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using ZW10 antibody (86726-1-RR, Clone: 251397A5 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86726-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ZW10 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86726-1-PBS

Clone No.251397A5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

HZW10

---

Product Information

86726-1-PBS targets ZW10 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag19138

  Product name: Recombinant human ZW10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 318-672 aa of BC128264

  Sequence: NEKTSTVPLAEMLGDMIWEDLSECLIKNCLVYSIPTNSSKLQQYEEIIQSTEEFENALKEMRFLKGDTTDLLKYARNINSHFANKKCQDVIVAARNLMTSEIHNTVKIIPDSKINVPELPTPDEDNKLEVQKVSNTQYHEVMNLEPENTLDQHSFSLPTCRISESVKKLMELAYQTLLEATTSSDQCAVQLFYSVRNIFHLFHDVVPTYHKENLQKLPQLAAIHHNNCMYIAHHLLTLGHQFRLRLAPILCDGTATFVDLVPGFRRLGTECFLAQMRAQKGELLERLSSARNFSNMDDEENYSAASKAVRQVLHQLKRLGIVWQDVLPVNIYCKAMGTLLNTAISEVIGKITALE

• Full Name: ZW10, kinetochore associated, homolog (Drosophila)
• Calculated Molecular Weight: 779 aa, 89 kDa
• Observed Molecular Weight: 88 kDa
• GenBank Accession Number: BC128264
• Gene Symbol: ZW10
• Gene ID (NCBI): 9183
• RRID: AB_3745082
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43264
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZW10 is the human homolog of the Drosophila melanogaster Zw10 protein. ZW10 is localized to kinetochores and kinetochore-associated microtubules and is an essential component of the mitotic checkpoint, which prevents cells from prematurely exiting mitosis(PMID: 17102640). ZW10 proteins in Drosophila and HeLa cells display a similar and intriguing cell cycle-dependent intracellular distribution. ZW10 protein first becomes localized to the kinetochore at prometaphase, but then appears to move onto the kinetochore microtubules of the spindle at metaphase, and then back to the kinetochore at anaphase(PMID: 9700164).