CoraLite® Plus 750-conjugated calreticulin Recombinant monoclonal antibody

• 

  WB analysis using CL750-80017

  Various lysates were subjected to SDS PAGE followed by western blot with CL750-80017 (calreticulin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  FC experiment of K-562 using CL750-80017

  1x10^6 K-562 cells were intracellularly stained with 0.4 ug CoraLite® Plus 750-conjugated calreticulin Recombinant antibody (CL750-80017, Clone:2B17)(red), or 0.4 ug Isotype Control (CL750-30000) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  FC experiment of Jurkat using CL750-80017

  1x10^6 Jurkat cells were intracellularly stained with 0.4 ug CoraLite® Plus 750-conjugated calreticulin Recombinant antibody (CL750-80017, Clone:2B17)(red), or 0.4 ug Isotype Control (CL750-30000) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

calreticulin Uni-rAb^® Recombinant Antibody for WB, FC (Intra)

Cat No. CL750-80017

Clone No.2B17

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra)

Synonyms

CALR, 2B17, Calregulin, CRT

---

Tested Applications

• Positive WB detected in: Jurkat cells, K-562 cells
• Positive FC (Intra) detected in: K-562 cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL750-80017 targets calreticulin in WB, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26064

  Product name: Recombinant human calreticulin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 248-417 aa of BC002500

  Sequence: KKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

• Full Name: calreticulin
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC002500
• Gene Symbol: Calreticulin
• Gene ID (NCBI): 811
• RRID: AB_3673721
• Conjugate: CoraLite® Plus 750 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 755 nm / 780 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P27797
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CALR, also named as grp60, ERp60, HACBP, CRP55, CRTC and Calregulin, belongs to the calreticulin family. It is a molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. CALR is a ER marker. It interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. CALR interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. The MW of CALR migrates aberrantly at 55 kDa by SDS-PAGE. Some study provided that it's a new possibility for CRT-mediated tumor immune prevention and treatment.