Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, NIH/3T3 cells, HSC-T6 cells, K-562 cells, Jurkat cells, HEK-293 cells |
| Positive IHC detected in | human tonsillitis tissue, rat skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, HT-29 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 ul suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67686-1-Ig targets cyclin B1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29444 Product name: Recombinant human CCNB1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-140 aa of BC006510 Sequence: MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEE Predict reactive species |
| Full Name | cyclin B1 |
| Calculated Molecular Weight | 48 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC006510 |
| Gene Symbol | Cyclin B1 |
| Gene ID (NCBI) | 891 |
| RRID | AB_2882879 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P14635 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cyclin B1 is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase of the cell cycle. The different transcripts result from the use of alternate transcription initiation sites. The antibody is specific to CCNB1. We got a 55-60 kDa band in western blotting maybe due to phosphorylation.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for cyclin B1 antibody 67686-1-Ig | Download protocol |
| IF protocol for cyclin B1 antibody 67686-1-Ig | Download protocol |
| IHC protocol for cyclin B1 antibody 67686-1-Ig | Download protocol |
| WB protocol for cyclin B1 antibody 67686-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Able is busy answering your previous question. Please try again later.
| Species | Application | Title |
|---|---|---|
Nat Commun SARS-CoV-2 NSP14 inhibitor exhibits potent antiviral activity and reverses NSP14-driven host modulation. | ||
Nat Commun A cell cycle-dependent transition of acetylation to phosphorylation regulates timely centrosome maturation. | ||
Genes Dis Integrative analysis of the transcriptome and metabolome reveals the importance of hepatokine FGF21 in liver aging | ||
Adv Sci (Weinh) Identification of PRDX5 as A Target for The Treatment of Castration-Resistant Prostate Cancer | ||
Phytomedicine Epiberberine induced p53/p21-dependent G2/M cell cycle arrest and cell apoptosis in gastric cancer cells by activating γ-aminobutyric acid receptor- β3 | ||
Phytomedicine Single-cell and bulk RNA-seq with machine learning reveals CCNB1/CDK1-mediated G2/M arrest as key anti-HCC mechanism of Fuzheng Xiaozheng Prescription.
|
Reviews
What customers say
The single review for this product was from a Western Blot application using mouse embryonic stem cells at a 1:1000 dilution. The reviewer gave a low rating (2 out of 5) and reported that multiple bands were detected on the membrane, suggesting the antibody showed poor specificity in their experiment. No other reviews are available for this catalog number.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Tsimafei (Verified Customer) (08-04-2024) | Multiple bands are detected on the membrane
 |
