hCG Beta Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85800-7-RR (same clone as 85800-7-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85800-7-RR (hCG Beta antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85800-7-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 85800-7-RR (same clone as 85800-7-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 85800-7-RR (hCG Beta antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85800-7-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 85800-7-RR (same clone as 85800-7-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 85800-7-RR (hCG Beta antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85800-7-PBS in a different storage buffer formulation.

hCG Beta Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 85800-7-PBS

Clone No.250118E6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

CGB, CGB,hCG, CG beta, CGB3, CGbeta

---

Product Information

85800-7-PBS targets hCG Beta in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3378

  Product name: Recombinant Human hCG Beta protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 21-165 aa of

  Sequence: SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ

• Full Name: hCG Beta
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 20-25 kDa
• Gene ID (NCBI): 1082
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P0DN86
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Beta-hCG (beta-human chorionic gonadotropin) is a glycoprotein hormone produced by the placenta during pregnancy. It is a critical marker used in both obstetrics and oncology for various diagnostic and monitoring purposes. hCG is composed of two subunits: an alpha subunit (similar to other glycoprotein hormones like LH, FSH, and TSH) and a unique beta subunit (β-hCG). The beta subunit is the primary focus for diagnostic tests due to its specificity. β-hCG is initially secreted by the syncytiotrophoblast cells surrounding the developing embryo and later by the placenta.