CoraLite® Plus 488-conjugated mDia1 Recombinant monoclonal antibody

mDia1 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-85708-2
Clone No.243001A5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

DIAPH1, DIAP1, DIAPH 1, Diaphanous related formin 1, Diaphanous-related formin-1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85708-2 targets mDia1 in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag14523

Product name: Recombinant human DIAP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1211-1272 aa of BC007411

Sequence: AFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVPAKVSKNSETFPTILEEAKELVGRAS

Predict reactive species
Full Name diaphanous homolog 1 (Drosophila)
Calculated Molecular Weight 1272 aa, 141 kDa
Observed Molecular Weight 140-150 kDa
GenBank Accession NumberBC007411
Gene Symbol mDia1
Gene ID (NCBI) 1729
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO60610
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

mDia1, also known as DIAPH1 or Diap1, is a mammalian diaphanous-related formin which is implicated in multiple physical and pathological events including cytoskeletal dynamics, autosomal hearing loss, and myelodysplasia. Depending upon the cell type and position in the cell cycle, mDia1 has been shown to localize to the cell cortex, trafficking endosomes, cleavage furrow, mid-bodies, and centrosomes, the cytoplasmic microtubule-organizing center crucial for cell division. Mutation of mDia1 has been linked to microcephaly. This antibody recognizes the endogenous mDia1 mainly around 140-150 kDa, while sometimes an additional 70 kDa can also be observed which is proposed to be a fragment of 140-150 kDa molecules (26011179).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 mDia1 antibody CL488-85708-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...