CoraLite® Plus 488-conjugated AMACR/p504S Monoclonal antibody

• 

  IF Staining of A431 using CL488-60240

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using CoraLite® Plus 488 p504S,AMACR antibody (CL488-60240, Clone: 2H9B5 ) at dilution of 1:200.

• 

  FC experiment of LNCaP using CL488-60240

  1X10^6 LNCaP cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human p504S,AMACR (CL488-60240, Clone:2H9B5) (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

AMACR/p504S Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-60240

Clone No.2H9B5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

Synonyms

AMACR, p504S, 2H9B5, 2-methylacyl-CoA racemase, Alpha-methylacyl-CoA racemase

---

Tested Applications

• Positive IF/ICC detected in: A431 cells
• Positive FC (Intra) detected in: LNCaP cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-60240 targets AMACR/p504S in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8720

  Product name: Recombinant human p504S,AMACR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-135 aa of BC009471

  Sequence: MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNS

• Full Name: alpha-methylacyl-CoA racemase
• Calculated Molecular Weight: 382 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC009471
• Gene Symbol: AMACR
• Gene ID (NCBI): 23600
• RRID: AB_2934427
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9UHK6
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

AMACR(Alpha-methylacyl-CoA racemase) belongs to the CaiB/BaiF CoA-transferase family. It is a mitochondrial and peroxisomal enzyme that catalyzes the conversion of 2R stereoisomers of phytanic and pristanic acid to their S counterparts. AMACR has previously been shown to be a highly sensitive marker for colorectal and clinically localized prostate cancer (PCa). However, AMACR expression is down-regulated at the transcript and protein level in hormone-refractory metastatic PCa, suggesting a hormone-dependent expression of AMACR(PMID:12213712). It has 3 isoforms produced by alternative splicing. Defects in AMACR are the cause of alpha-methylacyl-CoA racemase deficiency (AMACRD) and congenital bile acid synthesis defect type 4 (CBAS4).