pan-PKC Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• pan-PKC Polyclonal antibody, PBS Only (12919-1-PBS)

• 

  WB analysis using 12919-1-AP (same clone as 12919-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12919-1-AP (PKC Beta antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12919-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse thymus using 12919-1-AP (same clone as 12919-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 12919-1-AP (PKC beta antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12919-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 12919-1-AP (same clone as 12919-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12919-1-AP (PKC beta antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12919-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 12919-1-AP (same clone as 12919-1-PBS)

  IP result of anti-pan-PKC (IP:12919-1-AP, 4ug; Detection:12919-1-AP 1:2000) with mouse brain tissue lysate 2100 ug. This data was developed using the same antibody clone with 12919-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 12919-1-AP (same clone as 12919-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12919-1-AP (PKC beta antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 12919-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 12919-1-AP (same clone as 12919-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 12919-1-AP (pan-PKC antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12919-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 12919-1-AP (same clone as 12919-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12919-1-AP (PKC beta antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 12919-1-PBS in a different storage buffer formulation.

• 

  IF Staining of K-562 using 12919-1-AP (same clone as 12919-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed K-562 cells using pan-PKC antibody (12919-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 12919-1-PBS in a different storage buffer formulation.

• 

  IF Staining of zebrafish retina using 12919-1-AP (same clone as 12919-1-PBS)

  Immunofluorescence analysis of bipolar cells labelled with pan-PKC polyclonal antibody (12919-1-AP, green) on tissue sections of the zebrafish retina at 5 days post fertilisation. Dilution 1:300. Tissue fixed overnight in 4% PFA. Müller glia, red; DAPI, blue; HuC/D, magenta. Data generated by Natalia Jaroszynska in Professor Ryan MacDonald's lab, University College London, UK. This data was developed using the same antibody clone with 12919-1-PBS in a different storage buffer formulation.

• 

  FC experiment of K-562 using 12919-1-AP (same clone as 12919-1-PBS)

  1X10^6 K-562 cells were intracellularly stained with 0.4 ug Anti-Human PKC Beta (12919-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 12919-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

pan-PKC Polyclonal Antibody for WB, IHC, IF, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 12919-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, zebrafish

Applications

WB, IHC, IF, IF/ICC, FC (Intra), IP, Indirect ELISA

Synonyms

PKC beta, PRKCB, EC:2.7.11.13, PKC B, PKCB

---

Product Information

12919-1-PBS targets pan-PKC in WB, IHC, IF, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples.

• Tested Reactivity: human, mouse, rat, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3591

  Product name: Recombinant human PRKCB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 342-598 aa of BC036472

  Sequence: FNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHA

• Full Name: protein kinase C, beta
• Calculated Molecular Weight: 673 aa, 77 kDa
• Observed Molecular Weight: 77 kDa
• GenBank Accession Number: BC036472
• Gene Symbol: PRKCB
• Gene ID (NCBI): 5579
• RRID: AB_2237469
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05771
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. Protein kinase Cs (PKCs) are signaling molecules that play key roles in many cellular processes, including secretion, gene expression, proliferation, and muscle contraction. The PKC family is broadly divided into three subgroups: classical, novel, and atypical PKCs. These subgroups differ in both protein sequences and mechanistic requirements for catalytic activity. PKC beta is one of the PKC family members. PKC beta has been reported to be involved in many different cellular functions, such as B cell activation, apoptosis induction, endothelial cell proliferation, and intestinal sugar absorption. Studies in mice also suggest that this kinase may also regulate neuronal functions and correlate fear-induced conflict behavior after stress. This antibody can recognize PKC beta, PKC alpha, PKC gamma, PKC epsilon and PKC delta.