Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

BAX Monoclonal antibody

BAX Monoclonal Antibody for WB, IHC, IHC-Autostainer, IF/ICC, IP, ELISA

Cat No. 60267-1-Ig
Clone No. 4G5E8
Publications (796)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat and More (6)

Applications

WB, IHC, IHC-Autostainer, IF/ICC, IP, CoIP, ELISA
For FC, select conjugated version.

4G5E8, Apoptosis regulator BAX, Bcl2-L-4, Bcl-2-like protein 4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for BAX in ?

Tested Applications

Positive WB detected inHeLa cells, Caki-2 cells, EC109 cells, HepG2 cells, human testis tissue, A549 cells, MDA-MB-231 cells, MCF-7 cells. HepG2 cells, Daudi cells, Ramos cells, HEK-293 cells, COLO 320 cells, PC-12 cells, ROS1728 cells, Neuro-2a cells
Positive IP detected inTHP-1 cells
Positive IHC-Autostainer detected inhuman colon tissue
Positive IHC detected inhuman liver cancer tissue, human colon cancer tissue, human kidney tissue, human lung cancer tissue, human rectal cancer tissue, human stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:20000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)-AUTOSTAINERIHC-AUTOSTAINER : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60267-1-Ig targets BAX in WB, IHC, IHC-Autostainer, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, rabbit, canine, chicken, hamster, sheep
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag21068

Product name: Recombinant human BAX protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-192 aa of BC014175

Sequence: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG

Predict reactive species
Full Name BCL2-associated X protein
Calculated Molecular Weight 21 kDa
Observed Molecular Weight 21 kDa
GenBank Accession NumberBC014175
Gene Symbol BAX
Gene ID (NCBI) 581
RRIDAB_2848213
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ07812
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BAX, also named as BCL2L4, is a pro-apoptotic member of the Bcl-2 protein family, which plays a pivotal role in controlling cell life and death. Bax largely localizes to the cytoplasm of healthy cells, but accumulates on the outer mitochondrial membrane upon apoptosis induction (PMID: 9108035). BAX can commit a cell to apoptosis by translocation from the cytosol to the mitochondria and permeabilization of the outer mitochondrial membrane, which leads to the release of cytochrome c from mitochondria (PMID: 21763611). The expression of BAX is upregulated by the tumor suppressor protein p53, and BAX has been shown to be involved in p53-mediated apoptosis (PMID: 8183579).

Protocols

Product Specific Protocols
IF protocol for BAX antibody 60267-1-IgDownload protocol
IHC protocol for BAX antibody 60267-1-IgDownload protocol
IP protocol for BAX antibody 60267-1-IgDownload protocol
WB protocol for BAX antibody 60267-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The BAX Monoclonal antibody (4G5E8), catalog number 60267-1-Ig, has 796 citations published in journals including J Nanobiotechnology, Theranostics, Advanced Science, Cell Death & Disease, Phytomedicine, Int J Biol Macromol, J Med Chem, Biomed Pharmacother, Oxid Med Cell Longev, and Stem Cell Res Ther. Research fields encompass mitochondrial biology, apoptosis, ferroptosis, pyroptosis, cancer therapy, cardiovascular disease, neuroprotection, renal injury, oxidative stress, inflammation, nanomedicine, and drug delivery.

SpeciesApplicationTitle
mouseWB

Exploration (Beijing)

Modulating Lysine Crotonylation in Ulcerative Colitis Maintains Mitochondrial Homeostasis: Modulating Crotonylation in Ulcerative Colitis.

Authors - Tongtong Liu
mouseWB

Adv Mater

Manganese Galvanic Cells Intervene in Tumor Metabolism to Reinforce cGAS-STING Activation for Bidirectional Synergistic Hydrogen-Immunotherapy

Authors - Nailin Yang
rat

Bioact Mater

Bioinspired 0D mitochondrial bioenergetic actuators rewire cartilage progenitor cell metabolism for osteoarthritis remission.

Authors - Weiming Lin
mouse

Kidney Int

Phosphoglycerate mutase 5 initiates inflammation in acute kidney injury by triggering mitochondrial DNA release by dephosphorylating the pro-apoptotic protein Bax

Authors - Jingyao Li

Autophagy

Hypoxia-preconditioned dental pulp stem cells alleviate acetaminophen-induced liver failure via promoting MYC-HIF1A/HIF-1α-BNIP3-mediated mitophagy.

Authors - Junyi Li
mouseWB

Nat Commun

FGF21 modulates immunometabolic homeostasis via the ALOX15/15-HETE axis in early liver graft injury

Authors - Xinyu Yang
Loading...
||
New chat

Able™

正在加载,请稍候...