Tested Applications
| Positive WB detected in | HeLa cells, Caki-2 cells, EC109 cells, HepG2 cells, human testis tissue, A549 cells, MDA-MB-231 cells, MCF-7 cells. HepG2 cells, Daudi cells, Ramos cells, HEK-293 cells, COLO 320 cells, PC-12 cells, ROS1728 cells, Neuro-2a cells |
| Positive IP detected in | THP-1 cells |
| Positive IHC-Autostainer detected in | human colon tissue |
| Positive IHC detected in | human liver cancer tissue, human colon cancer tissue, human kidney tissue, human lung cancer tissue, human rectal cancer tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:20000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC)-AUTOSTAINER | IHC-AUTOSTAINER : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60267-1-Ig targets BAX in WB, IHC, IHC-Autostainer, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, rabbit, canine, chicken, hamster, sheep |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21068 Product name: Recombinant human BAX protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-192 aa of BC014175 Sequence: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG Predict reactive species |
| Full Name | BCL2-associated X protein |
| Calculated Molecular Weight | 21 kDa |
| Observed Molecular Weight | 21 kDa |
| GenBank Accession Number | BC014175 |
| Gene Symbol | BAX |
| Gene ID (NCBI) | 581 |
| RRID | AB_2848213 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q07812 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
BAX, also named as BCL2L4, is a pro-apoptotic member of the Bcl-2 protein family, which plays a pivotal role in controlling cell life and death. Bax largely localizes to the cytoplasm of healthy cells, but accumulates on the outer mitochondrial membrane upon apoptosis induction (PMID: 9108035). BAX can commit a cell to apoptosis by translocation from the cytosol to the mitochondria and permeabilization of the outer mitochondrial membrane, which leads to the release of cytochrome c from mitochondria (PMID: 21763611). The expression of BAX is upregulated by the tumor suppressor protein p53, and BAX has been shown to be involved in p53-mediated apoptosis (PMID: 8183579).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for BAX antibody 60267-1-Ig | Download protocol |
| IHC protocol for BAX antibody 60267-1-Ig | Download protocol |
| IP protocol for BAX antibody 60267-1-Ig | Download protocol |
| WB protocol for BAX antibody 60267-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The BAX Monoclonal antibody (4G5E8), catalog number 60267-1-Ig, has 796 citations published in journals including J Nanobiotechnology, Theranostics, Advanced Science, Cell Death & Disease, Phytomedicine, Int J Biol Macromol, J Med Chem, Biomed Pharmacother, Oxid Med Cell Longev, and Stem Cell Res Ther. Research fields encompass mitochondrial biology, apoptosis, ferroptosis, pyroptosis, cancer therapy, cardiovascular disease, neuroprotection, renal injury, oxidative stress, inflammation, nanomedicine, and drug delivery.
| Species | Application | Title |
|---|---|---|
Exploration (Beijing) Modulating Lysine Crotonylation in Ulcerative Colitis Maintains Mitochondrial Homeostasis: Modulating Crotonylation in Ulcerative Colitis. | ||
Adv Mater Manganese Galvanic Cells Intervene in Tumor Metabolism to Reinforce cGAS-STING Activation for Bidirectional Synergistic Hydrogen-Immunotherapy | ||
Bioact Mater Bioinspired 0D mitochondrial bioenergetic actuators rewire cartilage progenitor cell metabolism for osteoarthritis remission. | ||
Kidney Int Phosphoglycerate mutase 5 initiates inflammation in acute kidney injury by triggering mitochondrial DNA release by dephosphorylating the pro-apoptotic protein Bax | ||
Autophagy Hypoxia-preconditioned dental pulp stem cells alleviate acetaminophen-induced liver failure via promoting MYC-HIF1A/HIF-1α-BNIP3-mediated mitophagy. | ||
Nat Commun FGF21 modulates immunometabolic homeostasis via the ALOX15/15-HETE axis in early liver graft injury |
