• Featured Product
  • KD/KO Validated

CKB-Specific Recombinant monoclonal antibody

CKB-Specific Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 83522-5-RR
Clone No.240418D2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

CKB, KCRB, 240418D2, B CK, B-CK

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HAP1 cells, HEK-293 cells, SH-SY5Y cells, Y79 cells, mouse brain tissue, rat brain tissue
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:100-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83522-5-RR targets CKB-Specific in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7285

Product name: Recombinant human CKB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-381 aa of BC001190

Sequence: MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK

Predict reactive species
Full Name creatine kinase, brain
Calculated Molecular Weight 43 kDa
Observed Molecular Weight 40-45 kDa
GenBank Accession NumberBC001190
Gene Symbol CKB
Gene ID (NCBI) 1152
RRIDAB_3671149
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP12277
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CKBB, also named as B-CK and CKB, is a member of the ATP:guanido phosphotransferase protein family. It is a cytoplasmic enzyme involved in energy homeostasis. CKBB reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a heterodimer with a similar muscle isozyme in heart. CK isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa. CK MB consists of a dimer of nonidentical chains. With MM being the major form in skeletal muscle and myocardium, MB existing in myocardium, and BB existing in many tissues, especially brain.

Protocols

Product Specific Protocols
FC protocol for CKB-Specific antibody 83522-5-RRDownload protocol
IHC protocol for CKB-Specific antibody 83522-5-RRDownload protocol
WB protocol for CKB-Specific antibody 83522-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...