Filter: AllWBIPIHCIF/ICCFC (Intra)

WB analysis of HeLa using 26523-1-AP
WB result of CLTC antibody (26523-1-AP; 1:60000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CLTC transfected HeLa cells.
WB analysis using 26523-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 26523-1-AP (CLTC antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
WB analysis of pig brain using 26523-1-AP
pig brain tissue were subjected to SDS PAGE followed by western blot with 26523-1-AP (CLTC Antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
WB analysis of Raji using 26523-1-AP
Raji cells were subjected to SDS PAGE followed by western blot with 26523-1-AP (CLTC Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
WB analysis of HL-60 using 26523-1-AP
HL-60 cells were subjected to SDS PAGE followed by western blot with 26523-1-AP (CLTC Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
IP experiment of HeLa using 26523-1-AP
IP result of anti-CLTC (IP:26523-1-AP, 4ug; Detection:26523-1-AP 1:500) with HeLa cells lysate 2500ug.
IHC staining of human colon using 26523-1-AP
Immunohistochemical analysis of paraffin-embedded human normal colon slide using 26523-1-AP (CLTC antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human breast cancer using 26523-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 26523-1-AP (CLTC Antibody) at dilution of 1:200 (under 10x lens).
IHC staining of human breast cancer using 26523-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 26523-1-AP (CLTC Antibody) at dilution of 1:200 (under 40x lens).
IHC staining of human kidney using 26523-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26523-1-AP (CLTC Antibody) at dilution of 1:200 (under 10x lens).
IHC staining of human kidney using 26523-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26523-1-AP (CLTC Antibody) at dilution of 1:200 (under 40x lens).
IF Staining of HepG2 using 26523-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CLTC antibody (26523-1-AP) at dilution of 1:500 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
IF Staining of HeLa using 26523-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CLTC antibody (26523-1-AP) at dilution of 1:500 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
FC experiment of HeLa using 26523-1-AP
1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human CLTC (26523-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

Featured Product
KD/KO Validated

CLTC Polyclonal antibody

Name: CLTC Polyclonal antibody
Brand: Proteintech
SKU: 26523-1-AP

CLTC Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 26523-1-AP

Publications(11)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

Synonyms

CHC, CHC17, Clathrin heavy chain, Clathrin heavy chain 1, clathrin, heavy chain (Hc)

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 488

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (11)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HeLa cells, HL-60 cells, pig brain tissue, Raji cells, mouse brain tissue, rat brain tissue
Positive IP detected in	HeLa cells
Positive IHC detected in	human colon tissue, human breast cancer tissue, human kidney tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HepG2 cells, HeLa cells
Positive FC (Intra) detected in	HeLa cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:2000-1:10000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
Immunofluorescence (IF)/ICC	IF/ICC : 1:250-1:1000
Flow Cytometry (FC) (INTRA)	FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 1 publications below
WB	See 6 publications below
IF	See 6 publications below
CoIP	See 2 publications below

Product Information

26523-1-AP targets CLTC in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity	human, mouse, rat, pig
Cited Reactivity	human, mouse, bovine
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag25041 Product name: Recombinant human CLTC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC054489 Sequence: MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRM Predict reactive species
Full Name	clathrin, heavy chain (Hc)
Calculated Molecular Weight	192 kDa
Observed Molecular Weight	180 kDa
GenBank Accession Number	BC054489
Gene Symbol	CLTC
Gene ID (NCBI)	1213
RRID	AB_2880542
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q00610
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Clathrin is the major protein of the polyhedral coat of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. The clathrin molecule has a triskelion shape. Each clathrin triskelion is composed of three identical heavy chains (CLTC) (160-190 kDa) and three light chains of two types, LCA (CLTA) and LCB (CLTB) (30-40 kDa). The heavy chain provides the structural backbone of the clathrin lattice. (PMID: 9133677)

Protocols

Product Specific Protocols
FC protocol for CLTC antibody 26523-1-AP	Download protocol
IF protocol for CLTC antibody 26523-1-AP	Download protocol
IHC protocol for CLTC antibody 26523-1-AP	Download protocol
IP protocol for CLTC antibody 26523-1-AP	Download protocol
WB protocol for CLTC antibody 26523-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
		Emerg Microbes Infect CD1d facilitates African swine fever virus entry into the host cells via clathrin-mediated endocytosis Authors - Xin Chen View Article
human	WB	Autophagy AP2M1 mediates autophagy-induced CLDN2 (claudin 2) degradation through endocytosis and interaction with LC3 and reduces intestinal epithelial tight junction permeability. Authors - Ashwinkumar Subramenium Ganapathy View Article
human	IF	Br J Pharmacol A glycine-serine-alanine-rich peptide ameliorates Alzheimer-type neurodegeneration Authors - Si-Yuan Yao View Article
mouse	IF	Aging (Albany NY) The interaction protein of SORBS2 in myocardial tissue to find out the pathogenic mechanism of LVNC disease. Authors - Chunyan Li View Article
bovine	WB,IF	Vet Microbiol Invasion of Mycoplasma bovis into bovine synovial cells utilizing the clathrin-dependent endocytosis pathway. Authors - Koji Nishi KD Validated View Article
human	IF	FASEB J A genome-wide transposon mutagenesis screening identifies LppB as a key factor associated with Mycoplasma bovis colonization and invasion into host cells Authors - Shimei Lan View Article