Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated CLTC Polyclonal antibody

CLTC Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-26523

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

IF/ICC, FC (Intra)

CHC, CHC17, Clathrin heavy chain, Clathrin heavy chain 1, clathrin, heavy chain (Hc)

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-26523 targets CLTC in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25041

Product name: Recombinant human CLTC protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-351 aa of BC054489

Sequence: MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRM

Predict reactive species
Full Name clathrin, heavy chain (Hc)
Calculated Molecular Weight 192 kDa
Observed Molecular Weight 180 kDa
GenBank Accession NumberBC054489
Gene Symbol CLTC
Gene ID (NCBI) 1213
RRIDAB_3672799
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ00610
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Clathrin is the major protein of the polyhedral coat of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. The clathrin molecule has a triskelion shape. Each clathrin triskelion is composed of three identical heavy chains (CLTC) (160-190 kDa) and three light chains of two types, LCA (CLTA) and LCB (CLTB) (30-40 kDa). The heavy chain provides the structural backbone of the clathrin lattice. (PMID: 9133677)

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 CLTC antibody CL488-26523Download protocol
IF protocol for CL Plus 488 CLTC antibody CL488-26523Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...