CoraLite® Plus 488-conjugated CLTC Polyclonal antibody

• 

  IF Staining of HeLa using CL488-26523

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 CLTC antibody (CL488-26523) at dilution of 1:200.

• 

  FC experiment of HepG2 using CL488-26523

  1x10^6 HepG2 cells were intracellularly stained with 0.8 ug Coralite® Plus 488 CLTC Polyclonal Antibody (CL488-26523)(red), or 0.8 ug CoraLite® Plus 488-conjugated Rabbit IgG control Rabbit PolyAb (CL488-30000) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

CLTC Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-26523

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

IF/ICC, FC (Intra)

Synonyms

CHC, CHC17, Clathrin heavy chain, Clathrin heavy chain 1, clathrin, heavy chain (Hc)

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-26523 targets CLTC in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25041

  Product name: Recombinant human CLTC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC054489

  Sequence: MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRM

• Full Name: clathrin, heavy chain (Hc)
• Calculated Molecular Weight: 192 kDa
• Observed Molecular Weight: 180 kDa
• GenBank Accession Number: BC054489
• Gene Symbol: CLTC
• Gene ID (NCBI): 1213
• RRID: AB_3672799
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q00610
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Clathrin is the major protein of the polyhedral coat of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. The clathrin molecule has a triskelion shape. Each clathrin triskelion is composed of three identical heavy chains (CLTC) (160-190 kDa) and three light chains of two types, LCA (CLTA) and LCB (CLTB) (30-40 kDa). The heavy chain provides the structural backbone of the clathrin lattice. (PMID: 9133677)