MEF2D Recombinant monoclonal antibody

MEF2D Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 85801-5-RR
Clone No.250068B7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Myocyte-specific enhancer factor 2D

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, THP-1 cells, K-562 cells, U2OS cells, C2C12 cells, C6 cells, U266 cells
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85801-5-RR targets MEF2D in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5700

Product name: Recombinant human MEF2D protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 167-514 aa of BC040949

Sequence: SLVTSSLTDPRLLSPQQPALQRNSVSPGLPQRPASAGAMLGGDLNSANGACPSPVGNGYVSARASPGLLPVANGNSLNKVIPAKSPPPPTHSTQLGAPSRKPDLRVITSQAGKGLMHHLNNAQRLGVSQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFSSPGGLSLGNVTAWQQPQQPQQPQQPQPPQQQPPQPQQPQPQQPQQPQQPPQQQSHLVPVSLSNLIPGSPLPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYETGDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLDTWTLK

Predict reactive species
Full Name myocyte enhancer factor 2D
Calculated Molecular Weight 56 kDa
Observed Molecular Weight 55-60 kDa
GenBank Accession NumberBC040949
Gene Symbol MEF2D
Gene ID (NCBI) 4209
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14814
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MEF2D, also named as Myocyte-specific enhancer factor 2D, is a 521 amino acid protein, which belongs to the MEF2 family. MEF2D is expressed in t in myotubes and also in undifferentiated myoblasts. MEF2D as a transcriptional activator which binds specifically to the MEF2 element, found in numerous muscle-specific and stress-induced genes. MEF2D mediates cellular functions not only in skeletal and cardiac muscle development, but also in neuronal differentiation and survival. The calculated molecular weight of MEF2D is 55 kDa, but Phosphorylated MEF2D is 60 kDa.

Protocols

Product Specific Protocols
IF protocol for MEF2D antibody 85801-5-RRDownload protocol
IHC protocol for MEF2D antibody 85801-5-RRDownload protocol
WB protocol for MEF2D antibody 85801-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...