NF-M Monoclonal antibody

NF-M Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA
Cat No. 66396-1-Ig
Clone No.2E3B12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

NEFM, 2E3B12, NEF3, neurofilament, NF M

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat brain tissue, rat brain, mouse brain tissue, PC-12 cells
Positive IHC detected inmouse brain tissue, mouse cerebellum tissue, rat brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue
Positive IF/ICC detected inSH-SY5Y cells
Positive FC (Intra) detected inPC-12 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:20000
Immunohistochemistry (IHC)IHC : 1:200-1:2000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66396-1-Ig targets NF-M in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag22709

Product name: Recombinant human NEFM protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-97 aa of BC002421

Sequence: MSYTLDSLGNPSAYRRVTETRSSFSRVSGSPSSGFRSQSWSRGSPSTVSSSYKRSMLAPRLAYSSAMLSSAESSLDFSQSSSLLNGGSGPGGDYKLS

Predict reactive species
Full Name neurofilament, medium polypeptide
Calculated Molecular Weight 102 kDa
Observed Molecular Weight 140 kDa
GenBank Accession NumberBC002421
Gene Symbol NF-M
Gene ID (NCBI) 4741
RRIDAB_2881770
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP07197
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NEFM, also named as NEF3 and NFM, belongs to the intermediate filament family. Neurofilaments are the 10 nm intermediate filaments found specifically in neurons. They are a major component of the cell's cytoskeleton, and provide support for normal axonal radial growth. Neurofilaments usually contain three intermediate filament proteins: L, M, and H which are involved in the maintenance of neuronal caliber. The names given to the three major neurofilament subunits are based upon the apparent molecular weight of the mammalian subunits on SDS-PAGE: NF-L, 65-68 kDa; NF-M,140-160 kDa and NF-H, 200-220 kDa.

Protocols

Product Specific Protocols
FC protocol for NF-M antibody 66396-1-IgDownload protocol
IF protocol for NF-M antibody 66396-1-IgDownload protocol
IHC protocol for NF-M antibody 66396-1-IgDownload protocol
WB protocol for NF-M antibody 66396-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Reyes (Verified Customer) (10-03-2024)

NF-M in red worked very well marking my neurons (in green) in FFPE tissue and also the axons (neurofilaments).

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Human Brain Cortex
NF-M Antibody Immunofluorescence validation (1:100 dilution) in Human Brain Cortex (Cat no:66396-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...