CoraLite®594-conjugated NF-M Monoclonal antibody

NF-M Monoclonal Antibody for IF-P, FC (Intra)
Cat No. CL594-66396
Clone No.2E3B12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF-P, FC (Intra)

NEFM, 2E3B12, NEF3, neurofilament, NF M

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue
Positive FC (Intra) detected inPC-12 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66396 targets NF-M in IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag22709

Product name: Recombinant human NEFM protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-97 aa of BC002421

Sequence: MSYTLDSLGNPSAYRRVTETRSSFSRVSGSPSSGFRSQSWSRGSPSTVSSSYKRSMLAPRLAYSSAMLSSAESSLDFSQSSSLLNGGSGPGGDYKLS

Predict reactive species
Full Name neurofilament, medium polypeptide
Calculated Molecular Weight 102 kDa
Observed Molecular Weight 140 kDa
GenBank Accession NumberBC002421
Gene Symbol NF-M
Gene ID (NCBI) 4741
RRIDAB_3673502
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP07197
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

NEFM, also named as NEF3 and NFM, belongs to the intermediate filament family. Neurofilaments are the 10nm intermediate filaments found specifically in neurons. They are a major component of the cell's cytoskeleton, and provide support for normal axonal radial growth. Neurofilaments usually contain three intermediate filament proteins: L, M, and H which are involved in the maintenance of neuronal caliber. The names given to the three major neurofilament subunits are based upon the apparent molecular weight of the mammalian subunits on SDS-PAGE: NF-L, 65-68 kDa; NF-M,140-160 kDa and NF-H, 200-220 kDa.

Protocols

Product Specific Protocols
FC protocol for CL594 NF-M antibody CL594-66396Download protocol
IF protocol for CL594 NF-M antibody CL594-66396Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...