SEC22B Recombinant monoclonal antibody

SEC22B Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 85037-5-RR
Clone No.242659B3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, hamster

Applications

WB, IHC, FC (Intra), ELISA

242659B3, ER-Golgi SNARE of 24 kDa, ERS24, ERS-24, SEC22 vesicle-trafficking protein homolog B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, MCF-7 cells, CHO cells, mouse brain tissue, rat brain tissue, fetal human brain tissue, human placenta tissue
Positive IHC detected inmouse liver tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85037-5-RR targets SEC22B in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, hamster samples.

Tested Reactivity human, mouse, rat, hamster
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag12981

Product name: Recombinant human SEC22B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2-215 aa of BC001364

Sequence: VLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMRSTYAKLAAVAVFFIMLIVYVRFWWL

Predict reactive species
Full Name SEC22 vesicle trafficking protein homolog B (S. cerevisiae)
Calculated Molecular Weight 25 kDa
Observed Molecular Weight 24 kDa
GenBank Accession NumberBC001364
Gene Symbol SEC22B
Gene ID (NCBI) 9554
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75396
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Soluble N-ethylmaleimide-sensitive factor (NSF) attachment protein receptor (SNARE) proteins are critical components of the membrane fusion machinery (PMID: 20163564). SEC22B is a SNARE involved in endoplasmic reticulum (ER)/Golgi membrane trafficking. SEC22B localizes to the ER-Golgi intermediate compartment (ERGIC) and has been identified as a regulator of antigen crosspresentation (PMID: 22153078).

Protocols

Product Specific Protocols
FC protocol for SEC22B antibody 85037-5-RRDownload protocol
IHC protocol for SEC22B antibody 85037-5-RRDownload protocol
WB protocol for SEC22B antibody 85037-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...