Tested Applications
| Positive WB detected in | Transfected HEK-293T cells |
| Positive IF/ICC detected in | Transfected HEK-293 cells |
| Positive FC (Intra) detected in | Transfected HEK-293T cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
81202-2-RR targets mCherry in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with recombinant protein samples.
| Tested Reactivity | recombinant protein |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25320 Product name: Recombinant mCherry protein Source: e coli.-derived, PGEX-4T Tag: GST Sequence: VSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK Predict reactive species |
| Full Name | mCherry |
| Calculated Molecular Weight | 27 kDa |
| Gene Symbol | |
| Gene ID (NCBI) | |
| RRID | AB_3743372 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Red fluorescent proteins (RFPs) is a collective term referring to a heterogeneous group of red chromophore-carrying proteins, originating from various species and forming different protein lineages. The original RFP (dsRed) is a 225 amino acid fluorescent protein (25.9 kDa) derived from Discosoma sp.. It emits red light with a peak wavelength of 593 nm upon excitation by green light (excitation peak at 558 nm). When fused with other proteins, RFP serves as a versatile reporter protein e.g. for quantifying expression levels or facilitating visualization of subcellular localization through fluorescence microscopy. This antibody is a rabbit monoclonal antibody raised against mCherry.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for mCherry antibody 81202-2-RR | Download protocol |
| IF protocol for mCherry antibody 81202-2-RR | Download protocol |
| WB protocol for mCherry antibody 81202-2-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The mCherry Recombinant monoclonal antibody (241830F8), catalog number 81202-2-RR, has a total of 1 citation. It appears in the journal FEBS Open Bio (2026), in a study titled "Evaluating the involvement of autolysosomes in the nuclear translocation of fluorescent proteins." The associated research field is cell biology, specifically autolysosome function and fluorescent protein nuclear translocation, using the antibody for Western blot in human samples.
| Species | Application | Title |
|---|---|---|
FEBS Open Bio Evaluating the involvement of autolysosomes in the nuclear translocation of fluorescent proteins. |
Reviews
What customers say
The single review for this product is a 5-star rating from a Western Blot application at a 1:5,000 dilution on transfected HEK293T cells. The reviewer described the antibody as excellent, highlighting its strong signal and very clean results when detecting mCHERRY-tagged overexpressed proteins. Notably, no background was observed, indicating high specificity and sensitivity for this application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Christine (Verified Customer) (09-23-2025) | Excellent, strong and very clean antibody recognising mCHERRY tagged proteins overexpressed in HEK293T cells. No background at all.
|
