mCherry Recombinant monoclonal antibody

mCherry Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), ELISA
Cat No. 81202-2-RR
Clone No.241830F8

Host / Isotype

Rabbit / IgG

Reactivity

recombinant protein

Applications

WB, IF/ICC, FC (Intra), ELISA

241830F8

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inTransfected HEK-293T cells
Positive IF/ICC detected inTransfected HEK-293 cells
Positive FC (Intra) detected inTransfected HEK-293T cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81202-2-RR targets mCherry in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with recombinant protein samples.

Tested Reactivity recombinant protein
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25320

Product name: Recombinant mCherry protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-235 aa of

Sequence: VSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Predict reactive species
Full Name mCherry
Calculated Molecular Weight 27 kDa
Gene Symbol
Gene ID (NCBI)
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Red fluorescent proteins (RFPs) is a collective term referring to a heterogeneous group of red chromophore-carrying proteins, originating from various species and forming different protein lineages. The original RFP (dsRed) is a 225 amino acid fluorescent protein (25.9 kDa) derived from Discosoma sp.. It emits red light with a peak wavelength of 593 nm upon excitation by green light (excitation peak at 558 nm). When fused with other proteins, RFP serves as a versatile reporter protein e.g. for quantifying expression levels or facilitating visualization of subcellular localization through fluorescence microscopy. This antibody is a rabbit polyclonal antibody raised against mCherry.

Protocols

Product Specific Protocols
IF protocol for mCherry antibody 81202-2-RRDownload protocol
WB protocol for mCherry antibody 81202-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Christine (Verified Customer) (09-23-2025)

Excellent, strong and very clean antibody recognising mCHERRY tagged proteins overexpressed in HEK293T cells. No background at all.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5,000
  • Cell Tissue Type: Transfected HEK293T
Loading...
||
New chat Able
正在加载,请稍候...