CoraLite® Plus 488-conjugated mCherry Recombinant monoclonal antibody

mCherry Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-81202-2
Clone No.241830F8

Host / Isotype

Rabbit / IgG

Reactivity

recombinant protein

Applications

IF/ICC

241830F8

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inTransfected HEK-293 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-81202-2 targets mCherry in IF/ICC applications and shows reactivity with recombinant protein samples.

Tested Reactivity recombinant protein
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25320

Product name: Recombinant mCherry protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-235 aa of

Sequence: VSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Predict reactive species
Full Name mCherry
Calculated Molecular Weight 27 kDa
Gene Symbol
Gene ID (NCBI)
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Red fluorescent proteins (RFPs) is a collective term referring to a heterogeneous group of red chromophore-carrying proteins, originating from various species and forming different protein lineages. The original RFP (dsRed) is a 225 amino acid fluorescent protein (25.9 kDa) derived from Discosoma sp.. It emits red light with a peak wavelength of 593 nm upon excitation by green light (excitation peak at 558 nm). When fused with other proteins, RFP serves as a versatile reporter protein e.g. for quantifying expression levels or facilitating visualization of subcellular localization through fluorescence microscopy. This antibody is a rabbit polyclonal antibody raised against mCherry.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 mCherry antibody CL488-81202-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...