"COXIV Antibodies" Comparison
View side-by-side comparison of COXIV antibodies from other vendors to find the one that best suits your research needs.
Tested Applications
| Positive WB detected in | A431 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, LNCaP cells, K-562 cells |
| Positive IHC detected in | human prostate cancer tissue, human pancreas tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66110-1-Ig targets COXIV in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, bovine |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20551 Product name: Recombinant human COXIV protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-169 aa of BC021236 Sequence: MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK Predict reactive species |
| Full Name | cytochrome c oxidase subunit IV isoform 1 |
| Calculated Molecular Weight | 19.6 kDa |
| Observed Molecular Weight | 17-18 kDa |
| GenBank Accession Number | BC021236 |
| Gene Symbol | COX IV |
| Gene ID (NCBI) | 1327 |
| RRID | AB_2881509 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P13073 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
COX4I1, also named as COX4 and COXIV-1, belongs to the cytochrome c oxidase IV family. It is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COX4I1 is a marker for mitochondria. It has two isoforms (isoform 1 and 2). Isoform 1(COX4I1) is ubiquitously expressed and isoform 2 is highly expressed in lung tissues. COX4I1 is commonly used as a loading control. This antibody is specific to COX4I1 and do not cross reacts with COX4I2.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for COXIV antibody 66110-1-Ig | Download protocol |
| WB protocol for COXIV antibody 66110-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
COXIV Monoclonal antibody (2A7B2), catalog number 66110-1-Ig, has 67 citations. Publications appear in high-impact journals including Science, Cell, Nature Metabolism, Nature Immunology, Nature Cell Biology, Nature Communications, Molecular Cell, and Cell Death & Differentiation. Research fields span mitochondrial biology, mitophagy, cancer, neurodegeneration, kidney disease, diabetes, cardiovascular disorders, and metabolic regulation. The antibody is primarily used for Western blotting, with additional applications in immunofluorescence, immunohistochemistry, and immunoprecipitation across human, mouse, rat, and bovine species.
| Species | Application | Title |
|---|---|---|
Science Structural insight into the SAM-mediated assembly of the mitochondrial TOM core complex. | ||
Cell Metab Adipocyte-derived glutathione promotes obesity-related breast cancer by regulating the SCARB2-ARF1-mTORC1 complex | ||
Nat Immunol Dynamic mitochondrial transcription and translation in B cells control germinal center entry and lymphomagenesis | ||
Bioact Mater Copper doped bioactive glass promotes matrix vesicles-mediated biomineralization via osteoblast mitophagy and mitochondrial dynamics during bone regeneration |
Reviews
What customers say
Both reviewers report positive results. One user (4/5) used the antibody at 1:100 on mouse retina cryosections for IHC and found it worked well, recommending it. The other (5/5) used it at 1:1000 on mouse kidney lysates for Western blot as a mitochondrial loading control and was satisfied with the performance. Overall, the antibody is well-received across applications in mouse tissue.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Pooja (Verified Customer) (09-08-2025) | worked well in Mouse retina cryosection incubated with 1:100 CoxIV antibody at 4 degree overnight. Recommended.
|
Bryce (Verified Customer) (02-18-2022) | Decent loading control for mitochondria. I cut the blot too low, but you get the point.
 |
