Use Able AI chat for product recommendations

COXIV Monoclonal antibody

COXIV Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66110-1-Ig
Clone No.2A7B2

Host / Isotype

Mouse / IgG1

Reactivity

human and More (3)

Applications

WB, IHC, IF, IP, ELISA

COX4I1, 2A7B2, COX IV-1, COX4, Cytochrome c oxidase subunit 4 isoform 1, mitochondrial

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Filter:
  • Western Blot (WB) analysis of various lysates using COXIV Monoclonal antibody (66110-1-Ig)

    WB analysis using 66110-1-Ig

    Various lysates were subjected to SDS PAGE followed by western blot with 66110-1-Ig (COXIV antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

  • Western Blot (WB) analysis of various lysates using COXIV Monoclonal antibody (66110-1-Ig)

    WB analysis using 66110-1-Ig

    Various lysates were subjected to SDS PAGE followed by western blot with 66110-1-Ig (COXIV antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of HeLa cells using COXIV Monoclonal antibody (66110-1-Ig)

    WB analysis of HeLa using 66110-1-Ig

    HeLa cells were subjected to SDS PAGE followed by western blot with 66110-1-Ig (COXIV antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  • Immunohistochemistry (IHC) staining of human prostate cancer tissue using COXIV Monoclonal antibody (66110-1-Ig)

    IHC staining of human prostate cancer using 66110-1-Ig

    Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66110-1-Ig (COXIV antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human prostate cancer tissue using COXIV Monoclonal antibody (66110-1-Ig)

    IHC staining of human prostate cancer using 66110-1-Ig

    Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66110-1-Ig (COXIV antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human prostate cancer tissue using COXIV Monoclonal antibody (66110-1-Ig)

    IHC staining of human prostate cancer using 66110-1-Ig

    Immunohistochemical analysis of paraffin-embedded human prostate cancer using 66110-1-Ig(COXIV antibody) at dilution of 1:200 (under 10x lens).

  • Immunohistochemistry (IHC) staining of human prostate cancer tissue using COXIV Monoclonal antibody (66110-1-Ig)

    IHC staining of human prostate cancer using 66110-1-Ig

    Immunohistochemical analysis of paraffin-embedded human prostate cancer using 66110-1-Ig(COXIV antibody) at dilution of 1:200 (under 40x lens).

  • Immunohistochemistry (IHC) staining of human pancreas tissue using COXIV Monoclonal antibody (66110-1-Ig)

    IHC staining of human pancreas using 66110-1-Ig

    Immunohistochemical analysis of paraffin-embedded human pancreas using 66110-1-Ig(COXIV antibody) at dilution of 1:100 (under 10x lens).

  • Immunohistochemistry (IHC) staining of human pancreas tissue using COXIV Monoclonal antibody (66110-1-Ig)

    IHC staining of human pancreas using 66110-1-Ig

    Immunohistochemical analysis of paraffin-embedded human pancreas using 66110-1-Ig(COXIV antibody) at dilution of 1:100 (under 40x lens).

  • Immunohistochemistry (IHC) staining of human pancreas tissue using COXIV Monoclonal antibody (66110-1-Ig)

    IHC staining of human pancreas using 66110-1-Ig

    Immunohistochemical analysis of paraffin-embedded human pancreas using 66110-1-Ig(COXIV antibody) at dilution of 1:200 (under 10x lens).

  • Immunohistochemistry (IHC) staining of human pancreas tissue using COXIV Monoclonal antibody (66110-1-Ig)

    IHC staining of human pancreas using 66110-1-Ig

    Immunohistochemical analysis of paraffin-embedded human pancreas using 66110-1-Ig(COXIV antibody) at dilution of 1:200 (under 40x lens).

  • Immunohistochemistry (IHC) staining of human heart tissue using COXIV Monoclonal antibody (66110-1-Ig)

    IHC staining of human heart using 66110-1-Ig

    Immunohistochemical analysis of paraffin-embedded human heart using 66110-1-Ig(COXIV antibody) at dilution of 1:100 (under 10x lens).

  • Immunohistochemistry (IHC) staining of human heart tissue using COXIV Monoclonal antibody (66110-1-Ig)

    IHC staining of human heart using 66110-1-Ig

    Immunohistochemical analysis of paraffin-embedded human heart using 66110-1-Ig(COXIV antibody) at dilution of 1:100 (under 40x lens).

  • Immunohistochemistry (IHC) staining of human heart tissue using COXIV Monoclonal antibody (66110-1-Ig)

    IHC staining of human heart using 66110-1-Ig

    Immunohistochemical analysis of paraffin-embedded human heart using 66110-1-Ig(COXIV antibody) at dilution of 1:200 (under 10x lens).

  • Immunohistochemistry (IHC) staining of human heart tissue using COXIV Monoclonal antibody (66110-1-Ig)

    IHC staining of human heart using 66110-1-Ig

    Immunohistochemical analysis of paraffin-embedded human heart using 66110-1-Ig(COXIV antibody) at dilution of 1:200 (under 40x lens).

"COXIV Antibodies" Comparison

View side-by-side comparison of COXIV antibodies from other vendors to find the one that best suits your research needs.

Tested Applications

Positive WB detected inA431 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, LNCaP cells, K-562 cells
Positive IHC detected inhuman prostate cancer tissue, human pancreas tissue, human heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66110-1-Ig targets COXIV in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat, bovine
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag20551

Product name: Recombinant human COXIV protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-169 aa of BC021236

Sequence: MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK

Predict reactive species
Full Name cytochrome c oxidase subunit IV isoform 1
Calculated Molecular Weight19.6 kDa
Observed Molecular Weight 17-18 kDa
GenBank Accession NumberBC021236
Gene Symbol COX IV
Gene ID (NCBI) 1327
RRIDAB_2881509
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP13073
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COX4I1, also named as COX4 and COXIV-1, belongs to the cytochrome c oxidase IV family. It is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COX4I1 is a marker for mitochondria. It has two isoforms (isoform 1 and 2). Isoform 1(COX4I1) is ubiquitously expressed and isoform 2 is highly expressed in lung tissues. COX4I1 is commonly used as a loading control. This antibody is specific to COX4I1 and do not cross reacts with COX4I2.

Protocols

Product Specific Protocols
IHC protocol for COXIV antibody 66110-1-IgDownload protocol
WB protocol for COXIV antibody 66110-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Science

Structural insight into the SAM-mediated assembly of the mitochondrial TOM core complex.

Authors - Qiang Wang

Nat Immunol

Dynamic mitochondrial transcription and translation in B cells control germinal center entry and lymphomagenesis

Authors - Yavuz F Yazicioglu
humanWB

ACS Nano

Mitochondria-Targeting Polymer Micelle of Dichloroacetate Induced Pyroptosis to Enhance Osteosarcoma Immunotherapy.

Authors - Jiakang Jin
humanWB

Nat Cell Biol

Mitochondria-localised ZNFX1 functions as a dsRNA sensor to initiate antiviral responses through MAVS.

Authors - Yao Wang
humanWB

Mol Cell

Global mitochondrial protein import proteomics reveal distinct regulation by translation and translocation machinery

Authors - Jasmin Adriana Schafer
ratWB

Microbiome

The microbiota-gut-brain axis participates in chronic cerebral hypoperfusion by disrupting the metabolism of short-chain fatty acids.

Authors - Weiping Xiao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Pooja (Verified Customer) (09-08-2025)

worked well in Mouse retina cryosection incubated with 1:100 CoxIV antibody at 4 degree overnight. Recommended.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Mouse retina
FH

Bryce (Verified Customer) (02-18-2022)

Decent loading control for mitochondria. I cut the blot too low, but you get the point.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse Kidney
COXIV Antibody Western Blot validation (1:1000 dilution) in Mouse Kidney (Cat no:66110-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...