Tested Applications
| Positive WB detected in | THP-1 cells, U-937 cells, HL-60 cells |
| Positive IHC-Autostainer detected in | human tonsil tissue |
| Positive IHC detected in | rat brain tissue, mouse brain tissue, human liver tissue, human tonsil tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat brain tissue |
| Positive FC (Intra) detected in | THP-1 cells |
This antibody is not recommended for frozen sections.
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC)-AUTOSTAINER | IHC-AUTOSTAINER : 1:50-1:500 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:250-1:1000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
81728-1-RR targets IBA1 in WB, IHC, IHC-Autostainer, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag1363 Product name: Recombinant human IBA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC009474 Sequence: MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP Predict reactive species |
| Full Name | allograft inflammatory factor 1 |
| Calculated Molecular Weight | 17 kDa |
| Observed Molecular Weight | 17 kDa |
| GenBank Accession Number | BC009474 |
| Gene Symbol | IBA1 |
| Gene ID (NCBI) | 199 |
| ENSEMBL Gene ID | ENSG00000204472 |
| RRID | AB_2935574 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P55008 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IBA1 is a 143 amino acid cytoplasmic, inflammation response scaffold protein. It is constitutively expressed in monocytes and macrophages and is known to be involved in macrophage activation. It is a marker of activated macrophage. Expression of IBA1 is up-regulated in activated microglia following facial nerve axotomy, ischemia, and several brain diseases, thereby implicating it in the activated phenotypes of microglia.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for IBA1 antibody 81728-1-RR | Download protocol |
| IF protocol for IBA1 antibody 81728-1-RR | Download protocol |
| IHC protocol for IBA1 antibody 81728-1-RR | Download protocol |
| WB protocol for IBA1 antibody 81728-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The IBA1 Recombinant monoclonal antibody (4D5), catalog number 81728-1-RR, has 29 citations. These appear in journals including Nature Communications, Advanced Materials, Advanced Science, Gut Microbes, Frontiers in Immunology, Pharmacological Research, Journal of Neurochemistry, Neuroscience, and Brain Behavior. The research fields are dominated by neuroinflammation and microglia/macrophage biology, spanning ischemic stroke, Alzheimer's disease, gut–brain axis disorders, neurodegeneration, and related inflammatory and cognitive studies.
| Species | Application | Title |
|---|---|---|
Adv Mater Biomimetic Nanomotors for Deep Ischemia Penetration and Ferroptosis Inhibition in Neuroprotective Therapy of Ischemic Stroke | ||
Nat Commun Bifidobacterium bifidum-derived nanoparticles attenuate alcoholic liver disease via enhanced hepatic phagocytosis and gastrointestinal homeostasis. | ||
Nat Commun Integrated stress response inhibition prolongs the lifespan of a Pelizaeus-Merzbacher disease mouse model by increasing oligodendrocyte survival. | ||
Gut Microbes Simulated microgravity induces cerebral dysfunction by disturbing protective microbiota-metabolite-microglia signaling across the gut‒brain axis. | ||
Adv Sci (Weinh) Dual-Responsive Dynamic Covalent Bond-Based Assembly of Lipid-Nanozyme Systems via Multi-Target Synergy and Efficient Target Enrichment for Ischemic Stroke Therapy. | ||
Phytomedicine Paeonia × suffruticosa Andrews leaves improve endometriosis with anxiety/depression by regulating microglial polarization via JAK2/STAT3 pathway. |
Reviews
What customers say
The single review for this IBA1 antibody (used as a microglial-specific marker) is a 5-star rating. The user applied it for immunofluorescence on 40-μm-thick mouse brain cortex sections, with 3% normal goat serum blocking and overnight incubation at a 1:500 dilution. The antibody performed consistently well on the fixed tissue, producing clear IBA1 signal when detected with an Alexa 633-labeled anti-rabbit fluorescent secondary antibody. Overall, the reviewer found the product reliable and effective for visualizing microglia in fixed brain tissue.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Kateryna (Verified Customer) (01-23-2025) | IBA1 was used as a microglial-specific marker to visualize microglia in mouse brain tissue, specifically the cortex. The antibody worked consistently well on the fixed tissue: 40-μm thick sections, 3% normal goat serum blocking, and overnight incubation with the antibody (IBA1). In the image, red represents IBA1 visualized by an Alexa 633-labeled anti-rabbit fluorescent secondary antibody.
 |
