PTPN6/SHP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PTPN6/SHP1 Polyclonal antibody (24546-1-AP)

• Featured Product
• KD/KO Validated

PTPN6/SHP1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 24546-1-AP Copied!

Publications (26)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

Synonyms

PTPN6, SHP1, EC:3.1.3.48, HCP, HCPH

• 

  WB analysis using 24546-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24546-1-AP (PTPN6 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 24546-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24546-1-AP (PTPN6 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HuH-7 using 24546-1-AP

  HuH-7 cells were subjected to SDS PAGE followed by western blot with 24546-1-AP (SHP1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 24546-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24546-1-AP (SHP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Jurkat using 24546-1-AP

  IP result of anti-PTPN6 (IP:24546-1-AP, 4ug; Detection:24546-1-AP 1:600) with Jurkat cells lysate 3600ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 24546-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 24546-1-AP (PTPN6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 24546-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using PTPN6 antibody (24546-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 24546-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using PTPN6 antibody (24546-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of MCF-7 using 24546-1-AP

  1X10^6 MCF-7 cells were intracellularly stained with 0.2 ug Anti-Human PTPN6 (24546-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PTPN6/SHP1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, HuH-7 cells, Jurkat cells, Calu-1 cells, Raji cells
• Positive IP detected in: Jurkat cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells
• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24546-1-AP targets PTPN6/SHP1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21415

  Product name: Recombinant human PTPN6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 506-598 aa of BC002523

  Sequence: QYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK

• Full Name: protein tyrosine phosphatase, non-receptor type 6
• Calculated Molecular Weight: 597 aa, 68 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC002523
• Gene Symbol: PTPN6/SHP1
• Gene ID (NCBI): 5777
• RRID: AB_2879600
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P29350
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTPN6(Tyrosine-protein phosphatase non-receptor type 6) is also named as HCP, PTP1C and belongs to the protein-tyrosine phosphatase family. It regulates muscle INS action in a cell-autonomous manner, further suggesting that the PTPase negatively modulates INS action through down-regulation of both INS signaling to AKT1 and SLC2A4 translocation, as well as SLC2A4 expression(PMID:21952243). It has 4 isoforms produced by alternative splicing.

Publications

What published studies show

The SHP1 (PTPN6) affinity purification antibody 24546-1-AP has accumulated 26 citations in journals including Nature Communications, Cell Death & Differentiation, Cell Reports, eLife, PLoS Pathogens, Oncotarget, and the Journal of Biological Chemistry. Associated research fields encompass oncology (hepatocellular carcinoma, melanoma, ovarian and prostate cancer), immunology (innate immunity, T cell signaling, immune checkpoint regulation), ferroptosis, STAT3/JAK-STAT pathway modulation, and infectious disease (Mycobacterium tuberculosis).

Automatically generated from the 26 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Nat Commun; GBP2 condensates promote ferroptosis to sensitize anti-PD-L1 immunotherapy in melanoma.; Authors - Xin Liu
human	WB	Cell Death Differ; cGAS suppresses hepatocellular carcinoma independent of its cGAMP synthase activity; Authors - Dapeng Ma
human	WB,IP,IHC	Cell Death Dis; Anticancer activity of dietary xanthone α-mangostin against hepatocellular carcinoma by inhibition of STAT3 signaling via stabilization of SHP1.; Authors - Hai Zhang
		Cancer Lett; Neutrophil extracellular traps enhance platinum resistance in ovarian cancer via SHP-1 activation.; Authors - Qian Zhao
human	WB	Int J Biol Sci; PMID: 29805309; Authors - Linna Xie
human	IF,CoIP	Cell Commun Signal; 1-Pyrroline-5-carboxylate inhibit T cell glycolysis in prostate cancer microenvironment by SHP1/PKM2/LDHB axis; Authors - Lei Chang