CoraLite® Plus 647-conjugated PTPN6/SHP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 647-conjugated PTPN6/SHP1 Polyclonal antibody (CL647-24546)

• Featured Product
• KD/KO Validated

PTPN6/SHP1 Polyclonal Antibody for FC (Intra)

Cat No. CL647-24546

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

Synonyms

PTPN6, SHP1, EC:3.1.3.48, HCP, HCPH

• 

  FC experiment of MCF-7 using CL647-24546

  1x10^6 MCF-7 cells were intracellularly stained with 0.4 ug CoraLite® Plus 647-conjugated PTPN6/SHP1 Polyclonal antibody (CL647-24546)(red), or 0.4 ug Isotype Control (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.4 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-24546 targets PTPN6/SHP1 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21415

  Product name: Recombinant human PTPN6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 506-598 aa of BC002523

  Sequence: QYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK

• Full Name: protein tyrosine phosphatase, non-receptor type 6
• Calculated Molecular Weight: 597 aa, 68 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC002523
• Gene Symbol: PTPN6/SHP1
• Gene ID (NCBI): 5777
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P29350
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

PTPN6(Tyrosine-protein phosphatase non-receptor type 6) is also named as HCP, PTP1C and belongs to the protein-tyrosine phosphatase family. It regulates muscle INS action in a cell-autonomous manner, further suggesting that the PTPase negatively modulates INS action through down-regulation of both INS signaling to AKT1 and SLC2A4 translocation, as well as SLC2A4 expression(PMID:21952243). It has 4 isoforms produced by alternative splicing.