Tested Applications
| Positive WB detected in | L02 cells, COLO 320 cells |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse liver tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20634-1-AP targets CXCR2 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14670 Product name: Recombinant human IL-8RB/CXCR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-57 aa of BC037961 Sequence: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYAL Predict reactive species |
| Full Name | interleukin 8 receptor, beta |
| Calculated Molecular Weight | 360 aa, 41 kDa |
| Observed Molecular Weight | 45-50 kDa |
| GenBank Accession Number | BC037961 |
| Gene Symbol | IL8RB |
| Gene ID (NCBI) | 3579 |
| RRID | AB_10693624 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P25025 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IL8RB, also named as CXCR2, GRO/MGSA receptor, IL-8 receptor type 2, CDw128b, and CD182, belongs to the G-protein coupled receptor 1 family. It is a receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. The binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. It binds to IL-8 with high affinity. IL8RB also binds with high affinity to CXCL3, GRO/MGSA, and NAP-2.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CXCR2 antibody 20634-1-AP | Download protocol |
| IHC protocol for CXCR2 antibody 20634-1-AP | Download protocol |
| IP protocol for CXCR2 antibody 20634-1-AP | Download protocol |
| WB protocol for CXCR2 antibody 20634-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CXCR2 Polyclonal antibody (Cat# 20634-1-AP) has 51 citations. These appear in journals including ACS Nano, Science Advances, Cell Reports, Cell Death & Disease, EMBO Molecular Medicine, Journal of Experimental & Clinical Cancer Research, Advanced Science, Journal of Immunotherapy of Cancer, Journal of Neuroinflammation, and Journal of Biological Chemistry. Research fields span oncology (prostate, pancreatic, breast, colorectal, and other cancers), immunology and inflammation, neurology/pain, kidney disease, fibrosis, and cardiovascular research, with applications mainly in WB, IF, and IHC.
| Species | Application | Title |
|---|---|---|
J Extracell Vesicles Stromal cell-derived small extracellular vesicles enhance radioresistance of prostate cancer cells via interleukin-8-induced autophagy | ||
ACS Nano Charge-Adaptive Nanoparticle Attenuates Inflammation via Targeting Neutrophil Extracellular Traps (NETs) and Breaking NETs-Macrophage Crosstalk. | ||
J Adv Res Novel function of macrophage migration inhibitory factor in regulating post-infarct inflammation and the therapeutic significance | ||
J Nanobiotechnology Engineered neutrophil membrane-camouflaged nanocomplexes for targeted siRNA delivery against myocardial ischemia reperfusion injury | ||
J Exp Clin Cancer Res Inhibition of the chemokine receptors CXCR1 and CXCR2 synergizes with docetaxel for effective tumor control and remodeling of the immune microenvironment of HPV-negative head and neck cancer models | ||
Adv Sci (Weinh) CXCL6 Reshapes Lipid Metabolism and Induces Neutrophil Extracellular Trap Formation in Cholangiocarcinoma Progression and Immunotherapy Resistance |
