GLP1R Monoclonal antibody, PBS Only (Capture)

GLP1R Monoclonal Antibody for IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 60931-1-PBS
Clone No.1A4G5

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

IF/ICC, Cytometric bead array, Indirect ELISA

GLP 1 R, GLP 1 receptor, GLP 1R, GLP-1 receptor, GLP-1R

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60931-1-PBS targets GLP1R as part of a matched antibody pair:

MP51365-1: 60931-1-PBS capture and 60931-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag23529

Product name: Recombinant human GLP1R protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 26-145 aa of BC112126

Sequence: QGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY

Predict reactive species
Full Name glucagon-like peptide 1 receptor
Calculated Molecular Weight 463 aa, 53 kDa
GenBank Accession NumberBC112126
Gene Symbol GLP1R
Gene ID (NCBI) 2740
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP43220
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GLP1R (glucagon-like peptide-1 receptor) is a G protein-coupled receptor belonging to the secretin receptor superfamily, also known as class B (PMID:34911028). GLP1R is widely distributed in pancreatic islets, muscles, the gastrointestinal tract, the lung, liver, pancreas, and other tissues or organs (PMID:35989517). Moreover, GLP1R agonist has been reported to induce autophagy of EC (Endometrial carcinoma) cells, and high GLP1R expression may be associated with good prognosis of EC patients, suggesting that GLP1R is likely to participate in the progression of EC (PMID:29907137). Moreover, regarding the molecular weight of GLP1R, research shows that the bands at ~50 kDa and ~100 kDa belong to the monomer and dimer states of GLP1R (PMID: 28609478).

Loading...
||
New chat

Able

正在加载,请稍候...