CoraLite®594-conjugated NCALD Monoclonal antibody

• 

  IF Staining of HeLa using CL594-66088

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CoraLite®594 NCALD antibody (CL594-66088, Clone: 6B4E10 ) at dilution of 1:100.

NCALD Monoclonal Antibody for IF/ICC

Cat No. CL594-66088

Clone No.6B4E10

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, pig

Applications

IF/ICC

Synonyms

NCALD, neurocalcin delta

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66088 targets NCALD in IF/ICC applications and shows reactivity with human, mouse, pig samples.

• Tested Reactivity: human, mouse, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18760

  Product name: Recombinant human NCALD protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-193 aa of BC036098

  Sequence: MGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNRDGKLSMEEFIRGAKSDPSIVRLLQCDPSSAGQF

• Full Name: neurocalcin delta
• Calculated Molecular Weight: 193 aa, 22 kDa
• GenBank Accession Number: BC036098
• Gene Symbol: NCALD
• Gene ID (NCBI): 83988
• RRID: AB_2919946
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P61601
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

NCALD(Neurocalcin-delta) is a member of the EF-hand calcium-binding protein superfamily.It may be involved in the calcium-dependent regulation of rhodopsin phosphorylation.It is a high-affinity Ca2+ sensor (Kd of approx. 0.6 uM), which is most abundantly expressed in the Purkinje cells of the cerebellum(PMID:11964161).This antibody is specific to NCALD.