Tested Applications
| Positive WB detected in | serum from mouse injected with bacteria, pig liver tissue, rat liver tissue, serum from mouse injected with bacteria tissue |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human liver tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66250-1-Ig targets C-Reactive Protein/CRP in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, pig, monkey |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9883 Product name: Recombinant human CRP protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-91 aa of BC020766 Sequence: MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGPNVLNWRALKYEVQGEVFTKPQLWP Predict reactive species |
| Full Name | C-reactive protein, pentraxin-related |
| Calculated Molecular Weight | 224 aa, 25 kDa |
| Observed Molecular Weight | 27 kDa |
| GenBank Accession Number | BC020766 |
| Gene Symbol | CRP |
| Gene ID (NCBI) | 1401 |
| RRID | AB_2881638 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P02741 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
C-reactive protein (CRP) is an acute-phase serum protein synthesized by the liver in response to interleukin-6 (IL-6) during inflammation. The name of CRP derives from its ability to react with the C polysaccharide of Streptococcus pneumoniae. CRP is an annular, pentameric protein that belongs to the pentraxin family of proteins. CRP displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. It is used mainly as a marker of inflammation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for C-Reactive Protein/CRP antibody 66250-1-Ig | Download protocol |
| IHC protocol for C-Reactive Protein/CRP antibody 66250-1-Ig | Download protocol |
| WB protocol for C-Reactive Protein/CRP antibody 66250-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
66250-1-Ig is a C-reactive protein (CRP) antibody with 18 total citations. Citations appear in journals including Nature Communications, Advanced Science, EMBO Journal, Frontiers in Immunology, Scientific Reports, Neurotherapeutics, and others. Research fields span neuroinflammation, neuropathic pain, cerebral amyloid angiopathy, radiation injury, cholangiocarcinoma, autoimmune thyroiditis, stroke, ALS, metabolic dysfunction, and biosensor development.
| Species | Application | Title |
|---|---|---|
Nat Commun Macrophage lineage cells-derived migrasomes activate complement-dependent blood-brain barrier damage in cerebral amyloid angiopathy mouse model | ||
Adv Sci (Weinh) Neuronal C-Reactive Protein/FcγRI Positive Feedback Proinflammatory Signaling Contributes to Nerve Injury Induced Neuropathic Pain
| ||
EMBO J Fecal microbiota transplantation enhances cell therapy in a rat model of hypoganglionosis by SCFA-induced MEK1/2 signaling pathway | ||
Neurotherapeutics Telomerase mRNA-Lipid nanoparticles attenuate neuroinflammation after traumatic brain injury in mice. | ||
Int J Radiat Oncol Biol Phys Identification of Novel Biomarkers for Acute Radiation Injury Using Multiomics Approach and Nonhuman Primate Model | ||
Front Immunol Expression and clinical significance of interleukin-6 pathway in cholangiocarcinoma |
