Home
Products
Primary Antibodies
ANGPTL8/Betatrophin Monoclonal antibody (66641-1-Ig)

ANGPTL8/Betatrophin Monoclonal antibody

ANGPTL8/Betatrophin Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66641-1-Ig

Clone No. 2H9F9

Publications (1)

Review Product

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

Human and More (1)

Applications

WB, IHC, IF-P, ELISA

Synonyms

Angiopoietin-like protein 8, ANGPTL8, Betatrophin, C19orf80, Lipasin, LOC55908, PRO1185, PVPA599, td26

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

CoraLite®594

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF-P

WB analysis of human adipose using 66641-1-Ig
human adipose tissue were subjected to SDS PAGE followed by western blot with 66641-1-Ig (ANGPTL8/Betatrophin antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 66641-1-Ig
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66641-1-Ig (ANGPTL8/Betatrophin antibody) at dilution of 1:400 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 66641-1-Ig
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66641-1-Ig (ANGPTL8/Betatrophin antibody) at dilution of 1:400 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 66641-1-Ig
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66641-1-Ig (ANGPTL8/Betatrophin antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 66641-1-Ig
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66641-1-Ig (ANGPTL8/Betatrophin antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of human liver using 66641-1-Ig
Immunofluorescent analysis of (4% PFA) fixed human liver tissue using ANGPTL8/Betatrophin antibody (66641-1-Ig, Clone: 2H9F9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ANGPTL8/Betatrophin in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	human adipose tissue
Positive IHC detected in	human liver tissue, human liver cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF-P detected in	human liver tissue

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:8000
Immunohistochemistry (IHC)	IHC : 1:200-1:800
Immunofluorescence (IF)-P	IF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66641-1-Ig targets ANGPTL8/Betatrophin in WB, IHC, IF-P, ELISA applications and shows reactivity with Human samples.

Tested Reactivity	Human
Cited Reactivity	human
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag20708 Product name: Recombinant human LOC55908 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 117-251 aa of BC146552 Sequence: RNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA Predict reactive species
Full Name	hepatocellular carcinoma-associated gene TD26
Calculated Molecular Weight	251 aa, 28 kDa
Observed Molecular Weight	22 kDa
GenBank Accession Number	BC146552
Gene Symbol	ANGPTL8
Gene ID (NCBI)	55908
RRID	AB_2882000
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	Q6UXH0
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for ANGPTL8/Betatrophin antibody 66641-1-Ig	Download protocol
IHC protocol for ANGPTL8/Betatrophin antibody 66641-1-Ig	Download protocol
WB protocol for ANGPTL8/Betatrophin antibody 66641-1-Ig	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The ANGPTL8/Betatrophin Monoclonal antibody (2H9F9), catalog number 66641-1-Ig, has 1 total citation. It appears in the British Journal of Pharmacology (Impact Factor 7.5), published in February 2021. The cited study investigated sodium rutin's effects on lifespan, health span, and liver health in mice, using this antibody for Western blot analysis in human samples. The associated research fields include pharmacology, aging, and hepatic biology.

Species	Application	Title
human	WB	Br J Pharmacol Sodium rutin extends lifespan and health span in mice including positive impacts on liver health. Authors - Shuoshuo Li View Article