ANGPTL8/Betatrophin Monoclonal antibody, PBS Only

• 

  WB analysis of human adipose using 66641-1-Ig (same clone as 66641-1-PBS)

  human adipose tissue were subjected to SDS PAGE followed by western blot with 66641-1-Ig (ANGPTL8/Betatrophin antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66641-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66641-1-Ig (same clone as 66641-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66641-1-Ig (ANGPTL8/Betatrophin antibody) at dilution of 1:400 (under 40x lens). This data was developed using the same antibody clone with 66641-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66641-1-Ig (same clone as 66641-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66641-1-Ig (ANGPTL8/Betatrophin antibody) at dilution of 1:400 (under 10x lens). This data was developed using the same antibody clone with 66641-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66641-1-Ig (same clone as 66641-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66641-1-Ig (ANGPTL8/Betatrophin antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66641-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66641-1-Ig (same clone as 66641-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66641-1-Ig (ANGPTL8/Betatrophin antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66641-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human liver using 66641-1-Ig (same clone as 66641-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human liver tissue using ANGPTL8/Betatrophin antibody (66641-1-Ig, Clone: 2H9F9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66641-1-PBS in a different storage buffer formulation.

ANGPTL8/Betatrophin Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 66641-1-PBS

Clone No.2H9F9

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

Angiopoietin-like protein 8, ANGPTL8, Betatrophin, C19orf80, Lipasin, LOC55908, PRO1185, PVPA599, td26

---

Product Information

66641-1-PBS targets ANGPTL8/Betatrophin in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20708

  Product name: Recombinant human LOC55908 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 117-251 aa of BC146552

  Sequence: RNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA

• Full Name: hepatocellular carcinoma-associated gene TD26
• Calculated Molecular Weight: 251 aa, 28 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC146552
• Gene Symbol: ANGPTL8
• Gene ID (NCBI): 55908
• RRID: AB_2882000
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q6UXH0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.