Use Able AI chat for product recommendations

MBNL1 Monoclonal antibody

MBNL1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66837-1-Ig
Clone No. 1H2C12
Publications (8)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IP, ELISA

1H2C12, EXP, EXP35, EXP40, EXP42

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for MBNL1 in ?

Tested Applications

Positive WB detected inHeLa cells, rat heart tissue, Jurkat cells, HEK-293 cells, C2C12 cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:5000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66837-1-Ig targets MBNL1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7752

Product name: Recombinant human MBNL1 protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 1-343 aa of BC050535

Sequence: MGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM

Predict reactive species
Full Name muscleblind-like (Drosophila)
Calculated Molecular Weight 42 kDa
Observed Molecular Weight 40 kDa
GenBank Accession NumberBC050535
Gene Symbol MBNL1
Gene ID (NCBI) 4154
RRIDAB_2882180
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9NR56
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MBNL1 (muscleblind-like 1) is one of the MBNL proteins containing 3 members (MBNL1-3) in vertebrates. And MBNL1 is widely expressed in adult tissues including brain, heart and skeletal muscle (PMID:25274774). As a highly conserved RNA-binding protein, MBNL1 regulates alternative splicing, alternative polyadenylation, mRNA stability and mRNA localization in the nucleus. The neurological diseases DM1 and DM2 (myotonic dystrophy type 1 and type2) are caused by expansion of repetitive sequences in non-coding regions in the DMPK gene because of the inappropriate patterns of alternative splicing owing to MBNL1(PMID:24354850). The antibody could recognize the common full-length protein in applications.

Protocols

Product Specific Protocols
IF protocol for MBNL1 antibody 66837-1-IgDownload protocol
IHC protocol for MBNL1 antibody 66837-1-IgDownload protocol
WB protocol for MBNL1 antibody 66837-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-MBNL1 recombinant antibody (Cat# 66837-1-Ig) has 8 total citations published in Nucleic Acids Research, Cell Death & Disease, International Journal of Nanomedicine, Frontiers in Immunology, Scientific Reports, Genes, Cancer Biomarkers, and bioRxiv. Associated research fields include alternative splicing regulation, glioblastoma aerobic glycolysis, gastric cancer progression, cuproptosis in idiopathic pulmonary fibrosis, hepatocellular carcinoma, RNA foci characterization, clear cell renal cell carcinoma prognosis, and viral-mediated protein transfer.

SpeciesApplicationTitle
humanWB

Nucleic Acids Res

MEN1 is a regulator of alternative splicing and prevents R-loop-induced genome instability through suppression of RNA polymerase II elongation

Authors - Bangming Jin
humanWB,IP,IHC,IF

Cell Death Dis

The MBNL1/circNTRK2/PAX5 pathway regulates aerobic glycolysis in glioblastoma cells by encoding a novel protein NTRK2-243aa

Authors - Yubo Zhao
  • KD Validated
humanIF

Int J Nanomedicine

Exosome-Delivered circSTAU2 Inhibits the Progression of Gastric Cancer by Targeting the miR-589/CAPZA1 Axis

Authors - Chenggang Zhang
humanWB

Front Immunol

A comprehensive cuproptosis score and associated gene signatures reveal prognostic and immunological features of idiopathic pulmonary fibrosis

Authors - Chuanqing Jing
humanWB,IHC

Sci Rep

Hexahydrocurcumin suppresses hepatocellular carcinoma by regulating TRIM23/MBNL1 pathway.

Authors - Mi Wang
  • KD Validated
humanWB,IP,IF

Genes (Basel)

Comparative Analysis of MBNL1 Antibodies: Characterization of Recognition Sites and Detection of RNA Foci Colocalization

Authors - Yoshitaka Aoki
Loading...
||
New chat

Able™

正在加载,请稍候...