MBNL1 Monoclonal antibody, PBS Only

• 

  WB analysis using 66837-1-Ig (same clone as 66837-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66837-1-Ig (MBNL1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66837-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat heart using 66837-1-Ig (same clone as 66837-1-PBS)

  rat heart tissue were subjected to SDS PAGE followed by western blot with 66837-1-Ig (MBNL1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66837-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66837-1-Ig (same clone as 66837-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66837-1-Ig (MBNL1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66837-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66837-1-Ig (same clone as 66837-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66837-1-Ig (MBNL1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66837-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 66837-1-Ig (same clone as 66837-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using MBNL1 antibody (66837-1-Ig, Clone: 1H2C12 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red). This data was developed using the same antibody clone with 66837-1-PBS in a different storage buffer formulation.

MBNL1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66837-1-PBS

Clone No.1H2C12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1H2C12, EXP, EXP35, EXP40, EXP42

---

Product Information

66837-1-PBS targets MBNL1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7752

  Product name: Recombinant human MBNL1 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-343 aa of BC050535

  Sequence: MGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM

• Full Name: muscleblind-like (Drosophila)
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC050535
• Gene Symbol: MBNL1
• Gene ID (NCBI): 4154
• RRID: AB_2882180
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9NR56
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MBNL1 (muscleblind-like 1) is one of the MBNL proteins containing 3 members (MBNL1-3) in vertebrates. And MBNL1 is widely expressed in adult tissues including brain, heart and skeletal muscle (PMID:25274774). As a highly conserved RNA-binding protein, MBNL1 regulates alternative splicing, alternative polyadenylation, mRNA stability and mRNA localization in the nucleus. The neurological diseases DM1 and DM2 (myotonic dystrophy type 1 and type2) are caused by expansion of repetitive sequences in non-coding regions in the DMPK gene because of the inappropriate patterns of alternative splicing owing to MBNL1(PMID:24354850). The antibody could recognize the common full-length protein in applications.