Tested Applications
| Positive WB detected in | HEK-293 cells, U2OS cells, Daudi cells, A431 cells, LnCaP cells, Jurkat cells, K-562 cells, HepG2 cells, Raji cells |
| Positive IHC detected in | mouse liver tissue, human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67041-1-Ig targets DNASE1L3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28187 Product name: Recombinant human DNASE1L3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-305 aa of BC015831 Sequence: MSRELAPLLLLLLSIHSALAMRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS Predict reactive species |
| Full Name | deoxyribonuclease I-like 3 |
| Calculated Molecular Weight | 305 aa, 36 kDa |
| Observed Molecular Weight | 33-38 kDa |
| GenBank Accession Number | BC015831 |
| Gene Symbol | DNASE1L3 |
| Gene ID (NCBI) | 1776 |
| RRID | AB_2882355 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q13609 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Deoxyribonuclease 1-like 3 (DNASE1L3, DNase gamma, DNase Y, LS-DNase) is member of a DNASE1 protein family that is identified by similar biochemical properties such as Ca2+/Mg2+- dependency and an optimal pH of about 7.0 as well as by a high similarity in their nucleic acid and amino acid sequences (PMID:157967140). It is an endonuclease and cleaves double-stranded DNA (and single-stranded DNA) producing 3′-OH/5′-P ends, which is Ca2+/Mg2+-dependent and inhibited by Zn2+, but not by monomeric actin (PMID:9665719). In addition, it translocates from the endoplasmic reticulum to the nucleus during apoptosis (PMID: 23229555). DNASE1L3 can be located either in the cytoplasm or in the nucleus.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for DNASE1L3 antibody 67041-1-Ig | Download protocol |
| WB protocol for DNASE1L3 antibody 67041-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The DNASE1L3 Monoclonal antibody (Cat# 67041-1-Ig) has 7 citations across journals including ACS Nano, Cancer Letters, Journal of Translational Medicine, Aging, Oncology Research, Frontiers in Molecular Biosciences, and Human Genomics. Research fields span hepatocellular carcinoma, pancreatic cancer, colon cancer, tumor biomarkers, immune infiltration, Wnt/β-Catenin signaling, multi-omics analysis, and nano-enabled environmental remediation. Applications cited include WB and IHC.
| Species | Application | Title |
|---|---|---|
ACS Nano Nano-Enabled Zooremediation of Antibiotic Resistance Genes via Interfacial DNA Capture and Stimulated Nuclease Secretion. | ||
Cancer Lett Multi-omics analysis of polyamine metabolism implicates NT5E/CD73 in the progression of pancreatic cancer | ||
J Transl Med Prognostic implications and characterization of tumor-associated tertiary lymphoid structures genes in pancreatic cancer | ||
Aging (Albany NY) Deoxyribonuclease 1-like 3 may be a potential prognostic biomarker associated with immune infiltration in colon cancer. | ||
Oncol Res DNASE1L3 Mediates Hepatocellular Carcinoma Tumor Growth and Organoid Models via the Wnt/β-Catenin Signaling Pathway.
| ||
Front Mol Biosci Identification of DNASE1L3 as a novel biomarker of clinical stage in liver hepatocellular carcinoma. |
Reviews
What customers say
The single review for 67041-1-Ig reports successful use in immunofluorescence on mouse tumor-bearing liver FFPE tissue, with the antibody staining DNase1L3 in red. The reviewer used a 1:100 dilution and awarded a 5-star rating, indicating strong performance and satisfaction with the product's specificity and staining quality in this application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Tsz Tung (Verified Customer) (04-28-2022) | Work for mouse tumor-bearing liver FFPE-processed tissue (Red: DNase1L3)
 |
