DNASE1L3 Monoclonal antibody, PBS Only

• 

  WB analysis using 67041-1-Ig (same clone as 67041-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67041-1-Ig (DNASE1L3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67041-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67041-1-Ig (same clone as 67041-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67041-1-Ig (DNASE1L3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67041-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Daudi using 67041-1-Ig (same clone as 67041-1-PBS)

  Daudi cells were subjected to SDS PAGE followed by western blot with 67041-1-Ig (DNASE1L3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67041-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 67041-1-Ig (same clone as 67041-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 67041-1-Ig (DNASE1L3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67041-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 67041-1-Ig (same clone as 67041-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 67041-1-Ig (DNASE1L3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67041-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 67041-1-Ig (same clone as 67041-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 67041-1-Ig (DNASE1L3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67041-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 67041-1-Ig (same clone as 67041-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 67041-1-Ig (DNASE1L3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67041-1-PBS in a different storage buffer formulation.

DNASE1L3 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67041-1-PBS

Clone No.1A4D4

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

1A4D4, Deoxyribonuclease gamma, Deoxyribonuclease I-like 3, DHP2, DNAS1L3

---

Product Information

67041-1-PBS targets DNASE1L3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28187

  Product name: Recombinant human DNASE1L3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-305 aa of BC015831

  Sequence: MSRELAPLLLLLLSIHSALAMRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

• Full Name: deoxyribonuclease I-like 3
• Calculated Molecular Weight: 305 aa, 36 kDa
• Observed Molecular Weight: 33-38 kDa
• GenBank Accession Number: BC015831
• Gene Symbol: DNASE1L3
• Gene ID (NCBI): 1776
• RRID: AB_2882355
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13609
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Deoxyribonuclease 1-like 3 (DNASE1L3, DNase gamma, DNase Y, LS-DNase) is member of a DNASE1 protein family that is identified by similar biochemical properties such as Ca2+/Mg2+- dependency and an optimal pH of about 7.0 as well as by a high similarity in their nucleic acid and amino acid sequences (PMID:157967140). It is an endonuclease and cleaves double-stranded DNA (and single-stranded DNA) producing 3′-OH/5′-P ends, which is Ca2+/Mg2+-dependent and inhibited by Zn2+, but not by monomeric actin (PMID:9665719). In addition, it translocates from the endoplasmic reticulum to the nucleus during apoptosis (PMID: 23229555). DNASE1L3 can be located either in the cytoplasm or in the nucleus.