CoraLite® Plus 488-conjugated DNASE1L3 Monoclonal antibody

DNASE1L3 Monoclonal Antibody for IF/ICC
Cat No. CL488-67041
Clone No.1A4D4

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse

Applications

IF/ICC

Deoxyribonuclease gamma, deoxyribonuclease I like 3, DHP2, DNAS1L3, DNase gamma, DNase I homolog protein DHP2, DNase I like 3, DNASE1L3, Liver and spleen DNase, LS DNase, LSD

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67041 targets DNASE1L3 in IF/ICC applications and shows reactivity with Human, mouse samples.

Tested Reactivity Human, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28187

Product name: Recombinant human DNASE1L3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-305 aa of BC015831

Sequence: MSRELAPLLLLLLSIHSALAMRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

Predict reactive species
Full Name deoxyribonuclease I-like 3
Calculated Molecular Weight 305 aa, 36 kDa
Observed Molecular Weight 33-38 kDa
GenBank Accession NumberBC015831
Gene Symbol DNASE1L3
Gene ID (NCBI) 1776
RRIDAB_3084302
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13609
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Deoxyribonuclease 1-like 3 (DNASE1L3, DNase gamma, DNase Y, LS-DNase) is member of a DNASE1 protein family that is identified by similar biochemical properties such as Ca2+/Mg2+- dependency and an optimal pH of about 7.0 as well as by a high similarity in their nucleic acid and amino acid sequences [PMID:15796714]. It is an endonuclease and cleaves double-stranded DNA (and single-stranded DNA) producing 3′-OH/5′-P ends, which is Ca2+/Mg2+-dependent and inhibited by Zn2+, but not by monomeric actin [PMID:9665719]. In addition, it has been suggested to be involved in apoptotic DNA fragmentation of thymocytes' neuronal PC12 cells, C2C12 myoblasts and of cell lines expressing the recombinant nuclease [PMID: 7957253, 9307016]

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 DNASE1L3 antibody CL488-67041Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...