CoraLite®594-conjugated DNASE1L3 Monoclonal antibody

• 

  IF Staining of HepG2 using CL594-67041

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite®594 DNASE1L3 antibody (CL594-67041, Clone: 1A4D4 ) at dilution of 1:200, CL488-Phalloidin (green).

• 

  FC experiment of HepG2 using CL594-67041

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug CoraLite®594 Anti-Human DNASE1L3 (CL594-67041, Clone:1A4D4) (red), or 0.4 ug Mouse IgG2a Isotype Control (CL594-66360-2, Clone: K11A1B2A2) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

DNASE1L3 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL594-67041

Clone No.1A4D4

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

Synonyms

1A4D4, Deoxyribonuclease gamma, Deoxyribonuclease I-like 3, DHP2, DNAS1L3

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67041 targets DNASE1L3 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28187

  Product name: Recombinant human DNASE1L3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-305 aa of BC015831

  Sequence: MSRELAPLLLLLLSIHSALAMRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

• Full Name: deoxyribonuclease I-like 3
• Calculated Molecular Weight: 305 aa, 36 kDa
• Observed Molecular Weight: 33-38 kDa
• GenBank Accession Number: BC015831
• Gene Symbol: DNASE1L3
• Gene ID (NCBI): 1776
• RRID: AB_2920078
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13609
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Deoxyribonuclease 1-like 3 (DNASE1L3, DNase gamma, DNase Y, LS-DNase) is member of a DNASE1 protein family that is identified by similar biochemical properties such as Ca2+/Mg2+- dependency and an optimal pH of about 7.0 as well as by a high similarity in their nucleic acid and amino acid sequences [PMID:15796714]. It is an endonuclease and cleaves double-stranded DNA (and single-stranded DNA) producing 3′-OH/5′-P ends, which is Ca2+/Mg2+-dependent and inhibited by Zn2+, but not by monomeric actin [PMID:9665719]. In addition, it has been suggested to be involved in apoptotic DNA fragmentation of thymocytes' neuronal PC12 cells, C2C12 myoblasts and of cell lines expressing the recombinant nuclease [PMID: 7957253, 9307016]