Tested Applications
| Positive WB detected in | U2OS cells, A431 cells, PC-3 cells, HeLa cells, MDA-MB-231 cells |
| Positive IHC detected in | human liver cancer tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:20000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67656-1-Ig targets CYR61/CCN1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25129 Product name: Recombinant human CYR61 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 165-239 aa of BC001271 Sequence: EDSIKDPMEDQDGLLGKELGFDASEVELTRNNELIAVGKGSSLKRLPVFGMEPRILYNPLQGQKCIVQTTSWSQC Predict reactive species |
| Full Name | cysteine-rich, angiogenic inducer, 61 |
| Calculated Molecular Weight | 42 kDa |
| Observed Molecular Weight | 40-42 kDa |
| GenBank Accession Number | BC001271 |
| Gene Symbol | CYR61 |
| Gene ID (NCBI) | 3491 |
| RRID | AB_2882854 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O00622 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CYR61/CCN1 antibody 67656-1-Ig | Download protocol |
| IHC protocol for CYR61/CCN1 antibody 67656-1-Ig | Download protocol |
| WB protocol for CYR61/CCN1 antibody 67656-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Antibody 67656-1-Ig (anti-YAP1) has 11 total citations published in journals including Autophagy, Science Translational Medicine, iScience, MedComm, Journal of Orthopaedic Translation, Journal of Ethnopharmacology, Mechanisms of Ageing and Development, Biology of Reproduction, Environmental Toxicology, and Human Cell. Associated research fields span oncology (colorectal, gastric, laryngeal, hepatocellular carcinoma), diabetic cardiomyopathy, osteoarthritis, rheumatoid arthritis, cellular aging, autophagy, and preeclampsia.
| Species | Application | Title |
|---|---|---|
Autophagy Cardiac fibroblast-derived CCN1 aggravates diabetic cardiomyopathy through ITGAV-ITGB1/integrin αvβ1-mediated autophagy inhibition. | ||
Sci Transl Med Phase separation-based HTS identifies cobimetinib as a YAP-TEAD inhibitor that suppresses hyperactivated YAP-induced cancer progression | ||
J Orthop Translat Targeting the senescence-related genes MAPK12 and FOS to alleviate osteoarthritis | ||
J Ethnopharmacol Zhiwang decoction inhibits the inflammatory response and macrophage polarization in rheumatoid arthritis by mediating the PI3K/AKT phosphorylation pathway through cellular communication network factor 1. | ||
Mech Ageing Dev Cyr61 Promotes D-gal-induced Aging C2C12 Cell Fibrosis by Modulating Wnt/β-catenin Signaling Pathways |
