CoraLite®555-conjugated LARP1 Monoclonal antibody

LARP1 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL555-67810
Clone No.2E9F2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

LARP, La-related protein 1, La related protein 1, KIAA0731, 2E9F2

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL555-67810 targets LARP1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29993

Product name: Recombinant human LARP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-283 aa of BC033856

Sequence: MPRKRKTRHSSNPPLESHVGWVMDSREHRPRTASISSSPSEGTPTVGSYGCTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFKQLALEDAKEGYRYGLECLFRYYSYGLEKKFRLDIFKDFQEETVKDYEAGQLYGLEKFWAFLKYSKAKNLDIDPKLQEYLGKFRRLEDFRVDPPMGEEGNHKRHSVVAGGGGGEGRKRCPSQSSSRPAAMISQPPTPPTGQPVREDAKWTSQHSNTQTLGK

Predict reactive species
Full Name La ribonucleoprotein domain family, member 1
Calculated Molecular Weight 1096 aa, 124 kDa
Observed Molecular Weight140-150 kDa
GenBank Accession NumberBC033856
Gene Symbol LARP1
Gene ID (NCBI) 23367
RRIDAB_2919705
Conjugate CoraLite®555 Fluorescent Dye
Excitation/Emission Maxima Wavelengths557 nm / 570 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ6PKG0
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

LARP1, full named as La-related Protein 1, is an oncogenic RNA-binding protein required for ribosome biogenesis and cancer cell survival. (PMID: 32286153)It's has been proposed to function downstream of mTORC1 to regulate the translation of 5'TOP mRNAs such as those encoding ribosome proteins (RP). (PMID: 28650797) LARP1 has 2 isoforms with MW of 123-150KDa. With CL647, immunoflorecence detected location in cytoplasm.

Protocols

Product Specific Protocols
IF protocol for CL555 LARP1 antibody CL555-67810Download protocol
FC protocol for CL555 LARP1 antibody CL555-67810Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...