Filter: AllWBIHCIF-P

WB analysis of mouse testis using 67929-1-Ig
unboiled mouse testis tissue were subjected to SDS PAGE followed by western blot with 67929-1-Ig (SLC36A3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
WB analysis of COLO 320 using 67929-1-Ig
COLO 320 cells were subjected to SDS PAGE followed by western blot with 67929-1-Ig (SLC36A3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
IHC staining of mouse testis using 67929-1-Ig
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 67929-1-Ig (SLC36A3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse testis using 67929-1-Ig
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 67929-1-Ig (SLC36A3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of mouse testis using 67929-1-Ig
Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using SLC36A3 antibody (67929-1-Ig, Clone: 1A8E6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).
IF Staining of mouse testis using 67929-1-Ig
Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using SLC36A3 antibody (67929-1-Ig, Clone: 1A8E6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

SLC36A3 Monoclonal antibody

Name: SLC36A3 Monoclonal antibody
Brand: Proteintech
SKU: 67929-1-Ig

Cat No. 67929-1-Ig

Clone No.1A8E6

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

FLJ16658, PAT3, SLC36A3, TRAMD2, Tramdorin 2, tramdorin2

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 488

Size/Concentration:

Freight/Packing: -

Quantity

- +

Positive WB detected in	unboiled mouse testis tissue, COLO 320 cells
Positive IHC detected in	mouse testis tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF-P detected in	mouse testis tissue

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:6000
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
Immunofluorescence (IF)-P	IF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

67929-1-Ig targets SLC36A3 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, Mouse samples.

Tested Reactivity	Human, Mouse
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag16556 Product name: Recombinant human SLC36A3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 84-190 aa of BC101092 Sequence: VLTVHCMVILLNCAQHLSQRLQKTFVNYGEATMYGLETCPNTWLRAHAVWGRWNLALSPRLECSGKISAHCNPHLQGSSNSPAQASRVAGIYRYTVSFLLVITQLGF Predict reactive species
Full Name	solute carrier family 36 (proton/amino acid symporter), member 3
Calculated Molecular Weight	511 aa, 56 kDa
Observed Molecular Weight	51 kDa
GenBank Accession Number	BC101092
Gene Symbol	SLC36A3
Gene ID (NCBI)	285641
RRID	AB_2918681
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	Q495N2
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Product Specific Protocols
IF protocol for SLC36A3 antibody 67929-1-Ig	Download protocol
IHC protocol for SLC36A3 antibody 67929-1-Ig	Download protocol
WB protocol for SLC36A3 antibody 67929-1-Ig	Download protocol