Filter:
Tested Applications
| Positive IF-P detected in | mouse testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-67929 targets SLC36A3 in IF-P applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16556 Product name: Recombinant human SLC36A3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 84-190 aa of BC101092 Sequence: VLTVHCMVILLNCAQHLSQRLQKTFVNYGEATMYGLETCPNTWLRAHAVWGRWNLALSPRLECSGKISAHCNPHLQGSSNSPAQASRVAGIYRYTVSFLLVITQLGF Predict reactive species |
| Full Name | solute carrier family 36 (proton/amino acid symporter), member 3 |
| Calculated Molecular Weight | 511 aa, 56 kDa |
| Observed Molecular Weight | 51 kDa |
| GenBank Accession Number | BC101092 |
| Gene Symbol | SLC36A3 |
| Gene ID (NCBI) | 285641 |
| RRID | AB_2923829 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q495N2 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 SLC36A3 antibody CL488-67929 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
