CoraLite® Plus 488-conjugated AZI2 Monoclonal antibody

AZI2 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-68326
Clone No.2F1G5

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

AZI2/NAP1, 2F1G5, 5 azacytidine induced 2, 5-azacytidine-induced protein 2, Nak associated protein 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68326 targets AZI2 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6755

Product name: Recombinant human AZI2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-264 aa of BC001139

Sequence: MDALVEDDICILNHEKAHKRDTVTPVSIYSGDESVASHFALVTAYEDIKKRLKDSEKENSLLKKRIRFLEEKLIARFEEETSSVGREQVNKAYHAYREVCIDRDNLKSKLDKMNKDNSESLKVLNEQLQSKEVELLQLRTEVETQQVMRNLNPPSSNWEVEKLSCDLKIHGLEQELELMRKECSDLKIELQKAKQTDPYQEDNLKSRDLQKLSISSDNMQHAYWELKREMSNLHLVTQVQAELLRKLKTSTAIKKGKSLFTGNH

Predict reactive species
Full Name 5-azacytidine induced 2
Calculated Molecular Weight 45 kDa
Observed Molecular Weight 45 kDa
GenBank Accession NumberBC001139
Gene Symbol AZI2
Gene ID (NCBI) 64343
RRIDAB_3084474
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9H6S1
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

AZI2, also known as NAP1, is a TNF receptor (TNFR)-associated factor family member-associated NF-κB activator-binding kinase 1-binding protein that regulates the production of IFNs. It is an adapter protein which binds TBK1 and IKBKE playing a role in antiviral innate immunity. NAP1 is a kind of adapter protein which binds TBK1 and IKBKE playing a role in antiviral innate immunity. (PMID: 21931631)

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 AZI2 antibody CL488-68326Download protocol
IF protocol for CL Plus 488 AZI2 antibody CL488-68326Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...