LARP7 Recombinant monoclonal antibody, PBS Only (Capture)

LARP7 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 84950-3-PBS
Clone No.242561F5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

242561F5, HDCMA18P, hLARP7, La related protein 7, La-related protein 7

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84950-3-PBS targets LARP7 as part of a matched antibody pair:

MP01697-1: 84950-3-PBS capture and 84950-2-PBS detection (validated in Cytometric bead array)

MP01697-2: 84950-3-PBS capture and 84950-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag10850

Product name: Recombinant human LARP7 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 83-331 aa of BC006981

Sequence: LTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVNHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAIEFLNNPPEEAPRKPGIFPKTVKNKPIPALRVVEEKKKKKKKKGRMKKEDNIQAKEENMDTSNTSISKMKRSRPTSEGSDIESTEPQKQCSKKKKKRDRVEASSLPEVRTGKRKRSSSEDAESLAPRSKVKKIIQKDIIKEASEASKE

Predict reactive species
Full Name La ribonucleoprotein domain family, member 7
Calculated Molecular Weight 582 aa, 67 kDa
Observed Molecular Weight 67 kDa
GenBank Accession NumberBC006981
Gene Symbol LARP7
Gene ID (NCBI) 51574
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ4G0J3
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

LARP7 belongs to the LARP RNA-binding protein family, which includes the lupus LA antigen gene, and modulates the metabolism and function of a variety of RNA species [PMID:20138158]. LARP7 binds to the 7SK RNP complex, and sequesters the positive transcription elongation factor b (P-TEFb) in an inactive form, preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation.[PMID:19416841].

Loading...
||
New chat Able
正在加载,请稍候...