• All
  • Primary Antibodies
  • Conjugated Antibodies for IF
  • Conjugated Antibodies for FC
  • Secondary Antibodies
  • Antibody Labeling KitsNew
  • ELISA Kits
  • IHC Kits
  • Magnetic Cell Separation Kits
  • Cytokines & Growth Factors
  • Neutralizing/activating Antibodies
  • Nanobody-based Reagents
  • Accessory Products and Kits
  • Fusion Proteins
×
×
Host
0
Species Reactivity
0
Species Reactivity
0
Conjugate
0
Conjugate
0
Compatible Species
0
Conjugate
0
Filter:
  • Western Blot (WB) analysis of various lysates using HCLS1 Recombinant antibody (85114-1-RR)

    WB analysis using 85114-1-RR

    Various lysates were subjected to SDS PAGE followed by western blot with 85114-1-RR (HCLS1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of rat thymus tissue using HCLS1 Recombinant antibody (85114-1-RR)

    WB analysis of rat thymus using 85114-1-RR

    rat thymus tissue were subjected to SDS PAGE followed by western blot with 85114-1-RR (HCLS1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of mouse thymus tissue using HCLS1 Recombinant antibody (85114-1-RR)

    WB analysis of mouse thymus using 85114-1-RR

    mouse thymus tissue were subjected to SDS PAGE followed by western blot with 85114-1-RR (HCLS1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  • Immunohistochemistry (IHC) staining of mouse thymus tissue using HCLS1 Recombinant monoclonal antibody (85114-1-RR)

    IHC staining of mouse thymus using 85114-1-RR

    Immunohistochemical analysis of paraffin-embedded mouse thymus tissue slide using 85114-1-RR (HCLS1 antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of mouse thymus tissue using HCLS1 Recombinant monoclonal antibody (85114-1-RR)

    IHC staining of mouse thymus using 85114-1-RR

    Immunohistochemical analysis of paraffin-embedded mouse thymus tissue slide using 85114-1-RR (HCLS1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunofluorescence (IF) / fluorescent staining of HEL cells using HCLS1 Recombinant antibody (85114-1-RR)

    IF Staining of HEL using 85114-1-RR

    Immunofluorescent analysis of (4% PFA) fixed HEL cells using HCLS1 antibody (85114-1-RR, Clone: 242825E4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  • Immunofluorescence (IF) / fluorescent staining of Jurkat cells using HCLS1 Recombinant antibody (85114-1-RR)

    IF Staining of Jurkat using 85114-1-RR

    Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using HCLS1 antibody (85114-1-RR, Clone: 242825E4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  • Affinity and Kinetic Characterization of 85114-1-RR

    Affinity and Kinetic Characterization of 85114-1-RR

    Biolayer interferometry (BLl) kinetic assays of 85114-1-RR against Human HCLS1 were performed. The affinity constant is 4.71 nM.

HCLS1 Recombinant monoclonal antibody

HCLS1 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 85114-1-RR
Clone No.242825E4

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

242825E4, CTTNL, Hematopoietic cell-specific LYN substrate 1, Hematopoietic lineage cell-specific protein, HS1

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Tested Applications

Positive WB detected inJurkat cells, mouse thymus tissue, rat thymus tissue, Ramos cells, Daudi cells, Raji cells
Positive IHC detected inmouse thymus tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHEL cells, Jurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85114-1-RR targets HCLS1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag8645

Product name: Recombinant human HCLS1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 142-486 aa of BC016758

Sequence: GEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGETEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGARGLKAKFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVEEEPVYEAEPEPEPEPEPEPENDYEDVEEMDRHEQEDEPEGDYEEVLEPEDSSFSSALAGSSGCPAGAGAGAVALGISAVALYDYQGEGSDELSFDPDDVITDIEMVDEGWWRGRCHGHFGLFPANYVKLLE

Predict reactive species
Full Name hematopoietic cell-specific Lyn substrate 1
Calculated Molecular Weight 486 aa, 54 kDa
Observed Molecular Weight 75 kDa
GenBank Accession NumberBC016758
Gene Symbol HCLS1
Gene ID (NCBI) 3059
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP14317
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Hematopoietic cell-specific Lyn substrate 1 (HS1, HCLS1, LckBP1 and p75) is a 75-kDa intracellular protein expressed in cells of lymphohemopoietic origin. It was originally identified in B-lymphocytes as a major substrate of B-cell receptor (BCR)-induced phosphorylation after antigen (Ag) stimulation. It's a substrate of the antigen receptor-coupled tyrosine kinase. HCLS1 plays a role in antigen receptor signaling for both clonal expansion and deletion in lymphoid cells.

Protocols

Product Specific Protocols
WB protocol for HCLS1 antibody 85114-1-RRDownload protocol
IHC protocol for HCLS1 antibody 85114-1-RRDownload protocol
IF protocol for HCLS1 antibody 85114-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols