CoraLite® Plus 488-conjugated HCLS1 Recombinant monoclonal antibody

HCLS1 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-85114
Clone No.242825E4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

242825E4, CTTNL, Hematopoietic cell-specific LYN substrate 1, Hematopoietic lineage cell-specific protein, HS1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85114 targets HCLS1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag8645

Product name: Recombinant human HCLS1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 142-486 aa of BC016758

Sequence: GEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGETEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGARGLKAKFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVEEEPVYEAEPEPEPEPEPEPENDYEDVEEMDRHEQEDEPEGDYEEVLEPEDSSFSSALAGSSGCPAGAGAGAVALGISAVALYDYQGEGSDELSFDPDDVITDIEMVDEGWWRGRCHGHFGLFPANYVKLLE

Predict reactive species
Full Name hematopoietic cell-specific Lyn substrate 1
Calculated Molecular Weight 486 aa, 54 kDa
Observed Molecular Weight 75 kDa
GenBank Accession NumberBC016758
Gene Symbol HCLS1
Gene ID (NCBI) 3059
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP14317
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Hematopoietic cell-specific Lyn substrate 1 (HS1, HCLS1, LckBP1 and p75) is a 75-kDa intracellular protein expressed in cells of lymphohemopoietic origin. It was originally identified in B-lymphocytes as a major substrate of B-cell receptor (BCR)-induced phosphorylation after antigen (Ag) stimulation. It's a substrate of the antigen receptor-coupled tyrosine kinase. HCLS1 plays a role in antigen receptor signaling for both clonal expansion and deletion in lymphoid cells.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 HCLS1 antibody CL488-85114Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...