Home
Products
Primary Antibodies
Recombinant Antibodies
IGF2BP1 Recombinant monoclonal antibody, PBS Only (Detector) (88123-1-PBS)

Filter: AllWBIF/ICCCytometric bead array sample testCytometric bead array

WB analysis using 88123-1-RR (same clone as 88123-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 88123-1-RR (IGF2BP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88123-1-PBS in a different storage buffer formulation.
IF Staining of A375 using 88123-1-RR (same clone as 88123-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed A375 cells using IGF2BP1 antibody (88123-1-RR, Clone: 260323A4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 88123-1-PBS in a different storage buffer formulation.
Cytometric bead array sample test of MP03376-1
The mean IGF2BP1 concentration was determined to be 54.8 ng/mL in HEK-293 cell extract based on a 1.0 mg/mL extract load, 51.5 ng/mL in Caco-2 cell extract based on a 1.0 mg/mL extract load, 2.0 ng/mL in BxPC-3 cell extract based on a 1.0 mg/mL extract load.
Cytometric bead array standard curve of MP03376-1
Cytometric bead array standard curve of MP03376-1, IGF2BP1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 88123-2-PBS. Detection antibody: 88123-1-PBS. Standard: Ag18859. Range: 0.156-20 ng/mL.

IGF2BP1 Recombinant monoclonal antibody, PBS Only (Detector)

Name: IGF2BP1 Recombinant monoclonal antibody, PBS Only (Detector)
Brand: Proteintech
SKU: 88123-1-PBS

IGF2BP1 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 88123-1-PBS

Clone No.260323A4

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

Coding region determinant-binding protein, CRD-BP, IGF2 mRNA-binding protein 1, IGF2BP 1, IGF-II mRNA-binding protein 1

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

88123-1-PBS targets IGF2BP1 as part of a matched antibody pair:

MP03376-1: 88123-2-PBS capture and 88123-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag18859 Product name: Recombinant human IGF2BP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 126-198 aa of BC156957 Sequence: YSNREQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPL Predict reactive species
Full Name	insulin-like growth factor 2 mRNA binding protein 1
Calculated Molecular Weight	577 aa, 63 kDa
Observed Molecular Weight	63-70 kDa
GenBank Accession Number	BC156957
Gene Symbol	IGF2BP1
Gene ID (NCBI)	10642
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q9NZI8
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

IGF2BP1, also named as CRDBP, VICKZ1, ZBP1, is a 577 amino acid protein, which belongs to the RRM IMP/VICKZ family. IGF2BP1 can form homodimers and heterodimers with IGF2BP1 and IGF2BP3. IGF2BP1 is mainly expressed in the embryo, including in fetal liver, fetal lung, fetal kidney, fetal thymus and also expressed follicles of ovary, as well as in gonocytes of testis, spermatogonia, semen, oocytes and placenta. IGF2BP1 is Expressed in various cancers, including testis and lung cancers, as well as kidney, prostate and trachea cancers. IGF2BP1 as RNA-binding factor that recruits target transcripts to cytoplasmic protein-RNA complexes (mRNPs). It also modulates the rate and location at which target transcripts encounter the translational apparatus and shields them from endonuclease attacks or microRNA-mediated degradation. The calcualted molecular weight of IGF2BP1 is 63 kDa, but modified IGF2BP1 is about 65-70 kDa.