Tested Applications
| Positive FC (Intra) detected in | PMA and ionomycin stimulated C57BL/6 Th2-polarized splenocytes |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension |
| This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
98003-1-RR targets IL-13 in FC (Intra) applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg0266 Product name: Recombinant Mouse IL-13 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 26-131 aa of NM_008355 Sequence: SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF Predict reactive species |
| Full Name | interleukin 13 |
| Calculated Molecular Weight | 14 kDa |
| GenBank Accession Number | NM_008355 |
| Gene Symbol | IL-13 |
| Gene ID (NCBI) | 16163 |
| RRID | AB_3672147 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P20109 |
| Storage Buffer | PBS with 0.09% sodium azide, pH 7.3. |
| Storage Conditions | Store at 2-8°C. Stable for one year after shipment. |
Background Information
Interleukin 13 (IL-13) is an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. IL-13 up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. IL-13 inhibits the production of a series of cytokines like IL-1, IL-6, TNF-alpha, and IL-8 by activated human monocytes. IL-13 induces IFN-gamma production by NK cells. IL-13 is thought to be an important cytokine in the pathogenesis of asthma, and more recently has been shown to play a pivotal role in a number of fibrotic diseases, including hepatic and pulmonary fibrosis, and nodular sclerosing Hodgkin's disease.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for IL-13 antibody 98003-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Anti-Mouse IL-13 Rabbit Recombinant Antibody (2C14), catalog number 98003-1-RR, has a total of 1 citation. It appears in Toxicology and Applied Pharmacology (2025), where it was used in intracellular flow cytometry to study how solasodine inhibits the Th2 immune response and airway remodeling in asthmatic mice via the Runx3/NLRP3 pathway. The associated research fields include immunology, asthma pathogenesis, and toxicology.
| Species | Application | Title |
|---|---|---|
Toxicol Appl Pharmacol Solasodine inhibits the Th2 immune response and airway remodeling in asthmatic mice through the Runx3/NLRP3 pathway |
