Tested Applications
| Positive FC (Intra) detected in | IFN gamma, LPS and Brefeldin A treated human PBMCs |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension |
| This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
98137-1-RR targets CXCL8/IL-8 in FC (Intra) applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg0152 Product name: Recombinant Human CXCL8/IL-8 protein (Myc Tag, His Tag) Source: mammalian cells-derived, pHZ-KIsec Tag: Myc & 6*His Domain: 28-99 aa of BC013615 Sequence: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS Predict reactive species |
| Full Name | interleukin 8 |
| Calculated Molecular Weight | 99 aa, 11 kDa |
| GenBank Accession Number | BC013615 |
| Gene Symbol | IL-8 |
| Gene ID (NCBI) | 3576 |
| ENSEMBL Gene ID | ENSG00000169429 |
| RRID | AB_3672283 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P10145 |
| Storage Buffer | PBS with 0.09% sodium azide, pH 7.3. |
| Storage Conditions | Store at 2 - 8°C. Stable for one year after shipment. |
Background Information
Interleukin 8 (IL-8), also known as CXCL8, is a CXC chemokine family member. This chemokine is secreted by a variety of cell types including monocyte/macrophages, T cells, neutrophils, fibroblasts, endothelial cells, and various tumor cell lines in response to inflammatory stimuli. IL-8 has two primary functions. It induces chemotaxis in target cells, primarily neutrophils but also other granulocytes, causing them to migrate toward the site of infection. IL-8 also induces phagocytosis once they have arrived. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. IL-8 is also known to be a potent promoter of angiogenesis. IL-8 has been associated with tumor angiogenesis, metastasis, and poor prognosis in breast cancer. IL-8 may present a novel therapeutic target for estrogen driven breast carcinogenesis and tumor progression.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CXCL8/IL-8 antibody 98137-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Anti-Human CXCL8/IL-8 Rabbit Recombinant Antibody (240889B2), catalog number 98137-1-RR, has 1 citation to date. It appears in Scientific Reports (2025), in a study on bioinformatics analysis of NT5M-mediated immune evasion through PD-L1 and CXCL8 in pancreatic adenocarcinoma. The associated research field is oncology, specifically pancreatic cancer and tumor immune microenvironment.
| Species | Application | Title |
|---|---|---|
Sci Rep Bioinformatics analysis identifies NT5M modulates immune evasion through PD-L1 via CXCL8 in pancreatic adenocarcinoma |
Reviews
What customers say
The single review for this product rates it 5 stars. The reviewer used it for flow cytometry at a 1:1000 dilution and noted it as a CXCL8/IL-8 Uni-rAb (recombinant monoclonal antibody). Overall, the feedback is positive, indicating satisfactory performance in flow cytometry applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
s (Verified Customer) (12-28-2025) | CXCL8/IL-8 Uni-rAb
|
