Anti-Human CXCL8/IL-8 Rabbit Recombinant Antibody

CXCL8/IL-8 Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. 98137-1-RR
Clone No.240889B2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

CXCL8, IL8, IL-8, 240889B2, C X C motif chemokine 8

Formulation:  PBS, Azide
PBS, Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inIFN gamma, LPS and Brefeldin A treated human PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

98137-1-RR targets CXCL8/IL-8 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0152

Product name: Recombinant Human CXCL8/IL-8 protein (Myc Tag, His Tag)

Source: mammalian cells-derived, pHZ-KIsec

Tag: Myc & 6*His

Domain: 28-99 aa of BC013615

Sequence: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Predict reactive species
Full Name interleukin 8
Calculated Molecular Weight 99 aa, 11 kDa
GenBank Accession NumberBC013615
Gene Symbol IL-8
Gene ID (NCBI) 3576
ENSEMBL Gene IDENSG00000169429
RRIDAB_3672283
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP10145
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2 - 8°C. Stable for one year after shipment.

Background Information

Interleukin 8 (IL-8), also known as CXCL8, is a CXC chemokine family member. This chemokine is secreted by a variety of cell types including monocyte/macrophages, T cells, neutrophils, fibroblasts, endothelial cells, and various tumor cell lines in response to inflammatory stimuli. IL-8 has two primary functions. It induces chemotaxis in target cells, primarily neutrophils but also other granulocytes, causing them to migrate toward the site of infection. IL-8 also induces phagocytosis once they have arrived. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. IL-8 is also known to be a potent promoter of angiogenesis. IL-8 has been associated with tumor angiogenesis, metastasis, and poor prognosis in breast cancer. IL-8 may present a novel therapeutic target for estrogen driven breast carcinogenesis and tumor progression.

Protocols

Product Specific Protocols
FC protocol for CXCL8/IL-8 antibody 98137-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Sci Rep

Bioinformatics analysis identifies NT5M modulates immune evasion through PD-L1 via CXCL8 in pancreatic adenocarcinoma

Authors - Chaojie Zhai
Loading...
||
New chat Able
正在加载,请稍候...