Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CoraLite®594-conjugated Ki-67 Polyclonal antibody

Ki67 antibodies are widely used as markers for cell proliferation, enabling the detection and quantification of actively dividing cells in tissue samples for research and diagnostic applications, especially in cancer pathology. Proteintech has an extensive range of Ki-67 antibodies validated for WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), ELISA, Cell treatment and more.

Cat No. CL594-27309

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

KI67, MKI67, Antigen identified by monoclonal antibody Ki-67, Antigen KI-67, Ki 67

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inRamos cells, HeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

CL594-27309 targets Ki-67 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag26266

Product name: Recombinant human KI67 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1201-1300 aa of NM_002417

Sequence: AGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTPGHTEELVAAGKTTKIPCDSPQSDPVDTPTSTKQRPKRSIRKADVEGELLACRNLMPSAGKAMHTPK

Predict reactive species
Full Name antigen identified by monoclonal antibody Ki-67
Calculated Molecular Weight 359 kDa
GenBank Accession NumberNM_002417
Gene Symbol KI67
Gene ID (NCBI) 4288
RRIDAB_2919880
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP46013
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The Ki-67 protein (also known as MKI67) is a cellular marker for proliferation. Ki67 is present during all active phases of the cell cycle (G1, S, G2 and M), but is absent in resting cells (G0). Cellular content of Ki-67 protein markedly increases during cell progression through S phase of the cell cycle. Therefore, the nuclear expression of Ki67 can be evaluated to assess tumor proliferation by immunohistochemistry. It has been demonstrated to be of prognostic value in breast cancer. In head and neck cancer, several studies have reported an association between high proliferative activity and poorer prognosis.

Protocols

Product Specific Protocols
FC protocol for CL594 Ki-67 antibody CL594-27309Download protocol
IF protocol for CL594 Ki-67 antibody CL594-27309Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Oncol Rep

Zinc finger protein 180 induces an apoptotic phenotype by activating METTL14 transcriptional activity in colorectal cancer

Authors - Liang Xu
Loading...
||
New chat

Able

正在加载,请稍候...